Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0029.Seq
         (748 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.    21   7.9  
AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine recombi...    21   7.9  

>AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.
          Length = 712

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +1

Query: 16  EVHDEIPDRFC 48
           ++HD  PD+FC
Sbjct: 543 QIHDLSPDQFC 553


>AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine
           recombinase protein.
          Length = 340

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 10/40 (25%), Positives = 20/40 (50%)
 Frame = -1

Query: 664 RCYQTHRRPAHVVNX*SI**LTRPIVQRYSVXSAIXKKHA 545
           R + THR+P H  +  S+    + ++    V ++I   H+
Sbjct: 249 RLFLTHRKPFHPASTQSLSRWIKMVLAESGVDTSIYTAHS 288


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 102,255
Number of Sequences: 336
Number of extensions: 1344
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 19923648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)