Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0021.Seq
         (421 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1450.07c |||D-amino acid oxidase |Schizosaccharomyces pombe|...    27   0.90 
SPBC1734.09 |||NST UDP-N-acetylglucosamine transporter|Schizosac...    25   6.3  

>SPCC1450.07c |||D-amino acid oxidase |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 348

 Score = 27.5 bits (58), Expect = 0.90
 Identities = 13/46 (28%), Positives = 27/46 (58%)
 Frame = +3

Query: 144 YKYENYQISNFNTKILKL*VITSIDIPYDCHFFYTALLWLRHAAHW 281
           Y+ ++ +I ++NT +    VI   D+P +C + + A  +L +A H+
Sbjct: 103 YEPKHDKIRSWNTYVRDFKVIPEKDLPGECIYGHKATTFLINAPHY 148


>SPBC1734.09 |||NST UDP-N-acetylglucosamine
           transporter|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 316

 Score = 24.6 bits (51), Expect = 6.3
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = +2

Query: 209 FYRHSL*LPFFLY 247
           FY H+L LPFFL+
Sbjct: 191 FYTHALSLPFFLF 203


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,562,143
Number of Sequences: 5004
Number of extensions: 26591
Number of successful extensions: 54
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 54
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54
length of database: 2,362,478
effective HSP length: 66
effective length of database: 2,032,214
effective search space used: 148351622
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)