BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0021.Seq (421 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z19154-8|CAE17741.1| 335|Caenorhabditis elegans Hypothetical pr... 27 4.1 Z75955-11|CAB00125.1| 412|Caenorhabditis elegans Hypothetical p... 26 9.5 >Z19154-8|CAE17741.1| 335|Caenorhabditis elegans Hypothetical protein C40H1.9 protein. Length = 335 Score = 27.5 bits (58), Expect = 4.1 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +3 Query: 156 NYQISNFNTKI-LKL*VITSIDIPYDCHFFYTALLWLRHAAH 278 N + +TKI L+L T +PYD HF T +L L A+H Sbjct: 43 NSSFVSCSTKISLQLNCPTKPKVPYDEHFARTQMLALASASH 84 >Z75955-11|CAB00125.1| 412|Caenorhabditis elegans Hypothetical protein R07B7.16 protein. Length = 412 Score = 26.2 bits (55), Expect = 9.5 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 174 NLKFDNFRIYNITVLHNNKTDIMCREGKHTAL 79 N FD+ RI N+T + N ++C H+AL Sbjct: 186 NPVFDSSRIPNLTPVSNKAPKLICMTYMHSAL 217 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,656,662 Number of Sequences: 27780 Number of extensions: 149369 Number of successful extensions: 260 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 254 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 260 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 682028672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -