BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0021.Seq (421 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 22 3.2 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 22 3.2 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 22 3.2 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 22 3.2 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 22 3.2 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 3.2 AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 21 4.3 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 21 5.6 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 20 9.9 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 20 9.9 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 20 9.9 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 20 9.9 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 20 9.9 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 20 9.9 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 20 9.9 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 20 9.9 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 20 9.9 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 20 9.9 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 20 9.9 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 20 9.9 AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding prote... 20 9.9 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/32 (25%), Positives = 14/32 (43%) Frame = +3 Query: 144 YKYENYQISNFNTKILKL*VITSIDIPYDCHF 239 Y Y NY +N+ + I I +P ++ Sbjct: 89 YNYSNYNNNNYKQLCYNINYIEQIPVPVPVYY 120 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/32 (25%), Positives = 14/32 (43%) Frame = +3 Query: 144 YKYENYQISNFNTKILKL*VITSIDIPYDCHF 239 Y Y NY +N+ + I I +P ++ Sbjct: 89 YNYSNYNNNNYKQLCYNINYIEQIPVPVPVYY 120 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/32 (25%), Positives = 14/32 (43%) Frame = +3 Query: 144 YKYENYQISNFNTKILKL*VITSIDIPYDCHF 239 Y Y NY +N+ + I I +P ++ Sbjct: 89 YNYSNYNNNNYKQLCYNINYIEQIPVPVPVYY 120 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/32 (25%), Positives = 14/32 (43%) Frame = +3 Query: 144 YKYENYQISNFNTKILKL*VITSIDIPYDCHF 239 Y Y NY +N+ + I I +P ++ Sbjct: 89 YNYSNYNNNNYKQLCYNINYIEQIPVPVPVYY 120 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/32 (25%), Positives = 14/32 (43%) Frame = +3 Query: 144 YKYENYQISNFNTKILKL*VITSIDIPYDCHF 239 Y Y NY +N+ + I I +P ++ Sbjct: 89 YNYSNYNNNNYKQLCYNINYIEQIPVPVPVYY 120 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 3.2 Identities = 6/15 (40%), Positives = 8/15 (53%) Frame = +1 Query: 49 KLSTHCFFIIQCCMF 93 + HCF + CC F Sbjct: 738 RYEAHCFALCHCCDF 752 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 21.4 bits (43), Expect = 4.3 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 346 FSNCN*DFDLIFHETDIFM 290 F N N DFD+I + +I M Sbjct: 79 FKNGNFDFDMIVKQLEITM 97 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 5.6 Identities = 8/32 (25%), Positives = 14/32 (43%) Frame = +3 Query: 144 YKYENYQISNFNTKILKL*VITSIDIPYDCHF 239 Y Y NY +N+ + I I +P ++ Sbjct: 89 YNYSNYNNNNYKQLCYNINHIEQIPVPVPVYY 120 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 Query: 150 YENYQISNFNTKILKL*VITSIDIP 224 Y NY N+N + I I IP Sbjct: 98 YNNYNKHNYNKLYYNINYIEQIPIP 122 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 Query: 150 YENYQISNFNTKILKL*VITSIDIP 224 Y NY N+N + I I IP Sbjct: 98 YNNYNKHNYNKLYYNINYIEQIPIP 122 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 Query: 150 YENYQISNFNTKILKL*VITSIDIP 224 Y NY N+N + I I IP Sbjct: 98 YNNYNKHNYNKLYYNINYIEQIPIP 122 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 Query: 150 YENYQISNFNTKILKL*VITSIDIP 224 Y NY N+N + I I IP Sbjct: 98 YNNYNKHNYNKLYYNINYIEQIPIP 122 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 Query: 150 YENYQISNFNTKILKL*VITSIDIP 224 Y NY N+N + I I IP Sbjct: 98 YNNYNKHNYNKLYYNINYIEQIPIP 122 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 Query: 150 YENYQISNFNTKILKL*VITSIDIP 224 Y NY N+N + I I IP Sbjct: 98 YNNYNKHNYNKLYYNINYIEQIPIP 122 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 Query: 150 YENYQISNFNTKILKL*VITSIDIP 224 Y NY N+N + I I IP Sbjct: 98 YNNYNKHNYNKLYYNINYIEQIPIP 122 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 Query: 150 YENYQISNFNTKILKL*VITSIDIP 224 Y NY N+N + I I IP Sbjct: 98 YNNYNKHNYNKLYYNINYIEQIPIP 122 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 Query: 150 YENYQISNFNTKILKL*VITSIDIP 224 Y NY N+N + I I IP Sbjct: 98 YNNYNKHNYNKLYYNINYIEQIPIP 122 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 20.2 bits (40), Expect = 9.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 141 YYKYENYQISNFNTKILKL 197 Y Y NY +N+N KL Sbjct: 327 YNNYNNYNNNNYNNYNKKL 345 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 Query: 150 YENYQISNFNTKILKL*VITSIDIP 224 Y NY N+N + I I IP Sbjct: 331 YNNYNKHNYNKLYYNINYIEQIPIP 355 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 Query: 150 YENYQISNFNTKILKL*VITSIDIP 224 Y NY N+N + I I IP Sbjct: 331 YNNYNKHNYNKLYYNINYIEQIPIP 355 >AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding protein ASP6 protein. Length = 146 Score = 20.2 bits (40), Expect = 9.9 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = +2 Query: 272 SALVADHEYIRFMKD*IEVSVTVTKVRPTRRDKKKVCVSAPTHDWSLLD 418 S LVA + ++D + +T+ + + T ++ +KVC LLD Sbjct: 7 SLLVALLLVLLAIEDTMSKKMTIEEAKKTIKNLRKVCSKKNDTPKELLD 55 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,615 Number of Sequences: 438 Number of extensions: 2048 Number of successful extensions: 21 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10750329 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -