BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0015.Seq (476 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAP27G11.16 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 5.9 SPBC17D11.08 |||WD repeat protein, human WDR68 family|Schizosacc... 25 7.9 >SPAP27G11.16 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 104 Score = 25.0 bits (52), Expect = 5.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 252 AAHKCNYELFNRNNFSIRYWSWNYR 178 AA KC +E FSI + S+N++ Sbjct: 73 AASKCEFEKIWSTTFSISFLSFNFK 97 >SPBC17D11.08 |||WD repeat protein, human WDR68 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 435 Score = 24.6 bits (51), Expect = 7.9 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 432 FLARFEHSNLFKVKLSAHLDTHRRAPR*DFD 340 F A + L + LS H+ TH AP FD Sbjct: 143 FEAGIDSPLLCQASLSTHVKTHNNAPLTSFD 173 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,859,505 Number of Sequences: 5004 Number of extensions: 33734 Number of successful extensions: 71 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 184476110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -