BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0002.Seq (851 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 27 4.5 SPAC1399.01c |||purine permease |Schizosaccharomyces pombe|chr 1... 26 7.8 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 26.6 bits (56), Expect = 4.5 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +2 Query: 314 PIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQ-----HIPLSPAGVIAKRPAPIALPN 478 P P+ S ++ H + + +L N I+L ++PLSP A+ P+PI L + Sbjct: 172 PRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPYLPLSPTRSPARTPSPIRLYS 231 Query: 479 SCA 487 S A Sbjct: 232 SDA 234 >SPAC1399.01c |||purine permease |Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 25.8 bits (54), Expect = 7.8 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = -3 Query: 771 LRDWTPKXXIRVKVPLMAXPXENGFXPLDVGAHVLKWGPLSXIGTXFT 628 L DW P A P D H L WG IG F+ Sbjct: 229 LNDWAGGEGSCTGRPTEAEAPGYSLCPSDTSPHALGWGSAQFIGLGFS 276 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,235,702 Number of Sequences: 5004 Number of extensions: 62411 Number of successful extensions: 98 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 422462090 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -