BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0002.Seq (851 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70757-4|CAA94800.1| 1208|Caenorhabditis elegans Hypothetical pr... 31 1.0 Z92833-2|CAB07379.1| 891|Caenorhabditis elegans Hypothetical pr... 28 9.7 >Z70757-4|CAA94800.1| 1208|Caenorhabditis elegans Hypothetical protein ZK287.4 protein. Length = 1208 Score = 31.1 bits (67), Expect = 1.0 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 731 FP*WPXPXKTVXPXWTLEPTXLNGDPCPKLEQXSPXSRSIFG 606 +P P P T+ P TL P ++ P SP SRSI+G Sbjct: 691 YPSLPPPTTTISPLPTLLPPNISYVTSPPDNNDSPCSRSIYG 732 >Z92833-2|CAB07379.1| 891|Caenorhabditis elegans Hypothetical protein F38A6.2 protein. Length = 891 Score = 27.9 bits (59), Expect = 9.7 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -3 Query: 507 LPFAIQXAQLLGRAIGAGLFAITPAGE--RGMCCKAIKLGNARV 382 L F+ L G++IGA L T AGE G K +K G++RV Sbjct: 761 LDFSSDSQYLRGQSIGAHLLFWTKAGEICDGTSVKDVKWGSSRV 804 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,201,462 Number of Sequences: 27780 Number of extensions: 373763 Number of successful extensions: 616 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 616 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2118983636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -