BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0002.Seq (851 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 25 1.2 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 6.2 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 8.2 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 8.2 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 24.6 bits (51), Expect = 1.2 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +1 Query: 112 RAISPTQWKIFPSSL 156 RA+ PT+WK+ PS++ Sbjct: 578 RALWPTEWKVRPSTV 592 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.2 bits (45), Expect = 6.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 106 NSRAISPTQWKIFPSSLNLPYVQ*PILSDKETKDFS 213 N +I+ + I LN Y P DKETKD + Sbjct: 434 NDLSINEEKRTIENEQLNRMYKSYPNYIDKETKDMN 469 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.8 bits (44), Expect = 8.2 Identities = 9/24 (37%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = -2 Query: 130 EWVILLCYW*THGPN-SVVRNLYI 62 +W+ +L W H PN V N Y+ Sbjct: 653 KWLQVLALWLNHSPNYDQVTNWYM 676 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 8.2 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 376 SHDVVKRRPVNCNTTHYRANWVPGP 302 S + K++P +C+T YR V P Sbjct: 560 SDECNKKQPSDCDTLEYRNGEVTTP 584 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,633 Number of Sequences: 438 Number of extensions: 5243 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27431202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -