Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv1000
         (598 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8ILC5 Cluster: Putative uncharacterized protein; n=2; ...    36   0.55 

>UniRef50_Q8ILC5 Cluster: Putative uncharacterized protein; n=2;
            cellular organisms|Rep: Putative uncharacterized protein
            - Plasmodium falciparum (isolate 3D7)
          Length = 2700

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 1/54 (1%)
 Frame = +3

Query: 243  FRCNYFYKXTYFIKNIXKMN*CVNLDASWTRDIIYY-LLXGFCIK*LXINQLFI 401
            F+ N F K  YFIKN+  M  C N+  S    IIY   L  FC+  L ++ LFI
Sbjct: 2184 FKSNIFNKPFYFIKNLIIM--CANISFSKELTIIYINALIRFCLFELRMDNLFI 2235


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 394,618,142
Number of Sequences: 1657284
Number of extensions: 5545792
Number of successful extensions: 7930
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7762
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7927
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 41902926763
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)