BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0997 (667 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g40133.1 68414.m04768 hypothetical protein 29 3.7 At5g08580.1 68418.m01021 calcium-binding EF hand family protein ... 27 8.5 >At1g40133.1 68414.m04768 hypothetical protein Length = 663 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/42 (28%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = +1 Query: 358 GLVSFFQAYIYGCYYVKPLPK----YFTRFSMFLSLFCTQNI 471 G + ++ +IYGC+ P+P+ Y T + + LS Q++ Sbjct: 140 GFYTLYEGFIYGCFLWLPVPRLVLEYVTSYQIALSQITMQSL 181 >At5g08580.1 68418.m01021 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 391 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 259 GFIQIDILHPVSWISSSINDVFGWKM 336 GFI P SW+ S N+ FG+ M Sbjct: 186 GFISFSEYEPPSWVRKSDNNSFGYDM 211 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,571,819 Number of Sequences: 28952 Number of extensions: 304293 Number of successful extensions: 584 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1403159472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -