BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0994 (693 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 24 1.4 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 5.5 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 5.5 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 9.6 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.8 bits (49), Expect = 1.4 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = -3 Query: 307 LLLGLAPCCWFDVVAEASHPGHFG-AEPDF-VLPAPAGNCAXAXD 179 +LL L P CW+ + A + F AE +F L G A A + Sbjct: 1550 VLLDLDPACWYHLRVTAHNNAGFNVAEYEFATLTVTGGTIAPARE 1594 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -3 Query: 253 HPGHFGAEPDFVLPAP 206 HP H + P V P P Sbjct: 239 HPPHLSSHPAIVTPGP 254 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -3 Query: 253 HPGHFGAEPDFVLPAP 206 HP H + P V P P Sbjct: 131 HPPHLSSHPAIVTPGP 146 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/34 (29%), Positives = 14/34 (41%) Frame = +1 Query: 481 YRIEIFANSYLYWNVRXGVSNLELHRYHWIKDVI 582 YR+E A S Y + G + R W+ I Sbjct: 852 YRVEYSAASDAYTHAPEGFNEFYNQRRRWVPSTI 885 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/34 (29%), Positives = 14/34 (41%) Frame = +1 Query: 481 YRIEIFANSYLYWNVRXGVSNLELHRYHWIKDVI 582 YR+E A S Y + G + R W+ I Sbjct: 852 YRVEYSAASDAYTHAPEGFNEFYNQRRRWVPSTI 885 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/34 (29%), Positives = 14/34 (41%) Frame = +1 Query: 481 YRIEIFANSYLYWNVRXGVSNLELHRYHWIKDVI 582 YR+E A S Y + G + R W+ I Sbjct: 852 YRVEYSAASDAYTHAPEGFNEFYNQRRRWVPSTI 885 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/34 (29%), Positives = 14/34 (41%) Frame = +1 Query: 481 YRIEIFANSYLYWNVRXGVSNLELHRYHWIKDVI 582 YR+E A S Y + G + R W+ I Sbjct: 852 YRVEYSAASDAYTHAPEGFNEFYNQRRRWVPSTI 885 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 567 PMIPMQFQIRDPAPYV 520 P+ PMQ QI +P P + Sbjct: 408 PVPPMQSQIINPQPQI 423 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,044 Number of Sequences: 336 Number of extensions: 2736 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -