BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0994 (693 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 24 1.6 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 3.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 3.6 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 8.4 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 8.4 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 8.4 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 545 WNCIGIIGSKM*YFYHK*YIDEFICFGCILN 637 WN +G+ G+ + YF Y I G +LN Sbjct: 442 WNVLGVQGALLSYFIEPIYFHS-IVLGSLLN 471 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.6 bits (46), Expect = 3.6 Identities = 5/12 (41%), Positives = 9/12 (75%) Frame = -3 Query: 304 LLGLAPCCWFDV 269 ++G PCCW+ + Sbjct: 482 MIGYYPCCWWKI 493 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.6 bits (46), Expect = 3.6 Identities = 5/12 (41%), Positives = 9/12 (75%) Frame = -3 Query: 304 LLGLAPCCWFDV 269 ++G PCCW+ + Sbjct: 535 MIGYYPCCWWKI 546 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 154 QDLPHGVHRENXDGKN 107 Q++ GV REN GKN Sbjct: 16 QNIRGGVVRENSSGKN 31 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -1 Query: 681 TL*NRD**KFKYNS*FSIQPKHINSSIYY 595 T+ N + K+ YN+ ++ + N +YY Sbjct: 89 TIHNNNNYKYNYNNKYNYNNNNYNKKLYY 117 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 587 KNITSLIQ*YLCSSRLETPXLTFQ 516 + ++S+ Y C R E P ++FQ Sbjct: 644 EEVSSIETNYECGLRFEDPMISFQ 667 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,209 Number of Sequences: 438 Number of extensions: 3382 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -