BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0993 (672 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57180| Best HMM Match : Transglut_core (HMM E-Value=1.4e-14) 28 6.0 SB_34458| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_51241| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 >SB_57180| Best HMM Match : Transglut_core (HMM E-Value=1.4e-14) Length = 422 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -3 Query: 670 LSDALVFESQASTNFCNEIRTQEMLTIDFH--GEGITSCNKNQT 545 LS AL +++ TNF + T LTID H EGI C ++T Sbjct: 308 LSRALGIPTRSVTNFDSAHDTDGSLTIDTHFDEEGIIMCGTSRT 351 >SB_34458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1318 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 184 LHYTYFLMTL*AHCTLELPHYP 249 +HYTY ++ L H T + HYP Sbjct: 1172 VHYTYLVIVLPVHYTNRVSHYP 1193 >SB_51241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 184 LHYTYFLMTL*AHCTLELPHYP 249 +HYTY ++ L H T + HYP Sbjct: 143 VHYTYLVIVLPVHYTNRVSHYP 164 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,844,262 Number of Sequences: 59808 Number of extensions: 336384 Number of successful extensions: 619 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1721264831 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -