BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0992 (690 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 40 0.076 UniRef50_Q1DHC9 Cluster: Putative uncharacterized protein; n=1; ... 34 2.9 UniRef50_Q8SV02 Cluster: Putative uncharacterized protein ECU07_... 33 5.0 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 39.5 bits (88), Expect = 0.076 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +1 Query: 43 AGWWYLPARTHKSSYHQ 93 A WWYLPARTHK SYH+ Sbjct: 569 AEWWYLPARTHKRSYHR 585 >UniRef50_Q1DHC9 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 403 Score = 34.3 bits (75), Expect = 2.9 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -1 Query: 501 RGPRSCSRLKHYYCEL*VKFSWSVCGKGAEIRTP 400 RGP S+ + +YC++ W VC KGA ++ P Sbjct: 332 RGPDFVSKKEGFYCDMCTHTLWPVCHKGAAVQRP 365 >UniRef50_Q8SV02 Cluster: Putative uncharacterized protein ECU07_0900; n=1; Encephalitozoon cuniculi|Rep: Putative uncharacterized protein ECU07_0900 - Encephalitozoon cuniculi Length = 372 Score = 33.5 bits (73), Expect = 5.0 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = +2 Query: 5 TSRNALLLHGRTRQGGGTYPRGLTRAPTTSKKRFFSF 115 T RNALL+HG G TY RGL + R F F Sbjct: 112 TKRNALLVHGFNGSGNSTYMRGLAGHLSREGYRVFCF 148 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 574,087,242 Number of Sequences: 1657284 Number of extensions: 9645352 Number of successful extensions: 19204 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19202 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54132236449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -