BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0992 (690 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18B5.01c |bfr1|hba2, SPCPJ732.04c|brefeldin A efflux transpo... 26 4.5 SPBC119.17 ||SPBC577.01|metallopeptidase|Schizosaccharomyces pom... 26 4.5 >SPCC18B5.01c |bfr1|hba2, SPCPJ732.04c|brefeldin A efflux transporter Bfr1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1530 Score = 26.2 bits (55), Expect = 4.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 377 WRGLGIEYAYCTFNLIC*FIVVLFAFRLLLVTS 279 WR LGI Y FN+ +++ + FR++ + S Sbjct: 1488 WRNLGIFVGYVFFNIFA-VLLLFYVFRVMKLRS 1519 >SPBC119.17 ||SPBC577.01|metallopeptidase|Schizosaccharomyces pombe|chr 2|||Manual Length = 992 Score = 26.2 bits (55), Expect = 4.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 26 LHGRTRQGGGTYPRGLTRAPTTSKKRFFSF 115 LHG R+ GG Y GL+ + FF++ Sbjct: 848 LHGEIREKGGAYGAGLSYSGIDGVLSFFTY 877 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,409,274 Number of Sequences: 5004 Number of extensions: 42024 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -