BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0990 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 28 0.24 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 25 3.0 DQ080861-1|AAY89507.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080860-1|AAY89506.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080859-1|AAY89505.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080858-1|AAY89504.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080857-1|AAY89503.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080856-1|AAY89502.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080855-1|AAY89501.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080854-1|AAY89500.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080853-1|AAY89499.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080852-1|AAY89498.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080851-1|AAY89497.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080850-1|AAY89496.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080849-1|AAY89495.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080848-1|AAY89494.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080847-1|AAY89493.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080846-1|AAY89492.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080845-1|AAY89491.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080844-1|AAY89490.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080843-1|AAY89489.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080842-1|AAY89488.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080841-1|AAY89487.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080840-1|AAY89486.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080839-1|AAY89485.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080838-1|AAY89484.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080837-1|AAY89483.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080836-1|AAY89482.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080835-1|AAY89481.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080834-1|AAY89480.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080833-1|AAY89479.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 DQ080832-1|AAY89478.1| 54|Anopheles gambiae GPRgr13 protein. 24 5.2 AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B... 24 5.2 AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B... 24 5.2 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 9.0 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 28.3 bits (60), Expect = 0.24 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +2 Query: 86 ISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSE 235 I+Y D ++ F + + DY++ VK+ND NL ++ DDS+ Sbjct: 241 ITYNDVERF--FLDIVKETVDYREANNVKRNDFMNLMLQIKNKGKLDDSD 288 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +2 Query: 101 QQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELS 217 ++ +N K++ + L+ ++ +K LEE EELS Sbjct: 173 EESMNLLRESEGKLEKISEYLRTIEDRLKTLEEEKEELS 211 >DQ080861-1|AAY89507.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080860-1|AAY89506.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080859-1|AAY89505.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080858-1|AAY89504.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080857-1|AAY89503.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080856-1|AAY89502.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080855-1|AAY89501.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080854-1|AAY89500.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080853-1|AAY89499.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080852-1|AAY89498.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080851-1|AAY89497.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080850-1|AAY89496.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080849-1|AAY89495.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080848-1|AAY89494.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080847-1|AAY89493.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080846-1|AAY89492.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080845-1|AAY89491.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080844-1|AAY89490.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080843-1|AAY89489.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080842-1|AAY89488.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080841-1|AAY89487.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080840-1|AAY89486.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080839-1|AAY89485.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080838-1|AAY89484.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080837-1|AAY89483.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080836-1|AAY89482.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080835-1|AAY89481.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080834-1|AAY89480.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080833-1|AAY89479.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >DQ080832-1|AAY89478.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 87 FHMKINKKLTSLLVSMLKLTIIRM 158 FH IN L SL SMLK+ I M Sbjct: 21 FHATINTFLLSLNHSMLKINIAGM 44 >AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B precursor protein. Length = 423 Score = 23.8 bits (49), Expect = 5.2 Identities = 14/49 (28%), Positives = 29/49 (59%), Gaps = 3/49 (6%) Frame = +2 Query: 77 DVHISYEDQQKINKFARLNAKVDDYKD-ELKVKQNDVKN--LEEAVEEL 214 ++ + + D K+ + ARL +D+K E ++Q+D++ + E V+EL Sbjct: 49 EIEVDFWDAPKVGRSARLMVTREDHKRVEEFLEQHDIEYDLVAEDVQEL 97 >AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B protein. Length = 423 Score = 23.8 bits (49), Expect = 5.2 Identities = 14/49 (28%), Positives = 29/49 (59%), Gaps = 3/49 (6%) Frame = +2 Query: 77 DVHISYEDQQKINKFARLNAKVDDYKD-ELKVKQNDVKN--LEEAVEEL 214 ++ + + D K+ + ARL +D+K E ++Q+D++ + E V+EL Sbjct: 49 EIEVDFWDAPKVGRSARLMVTREDHKRVEEFLEQHDIEYDLVAEDVQEL 97 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = -3 Query: 436 PHFPS*CGYQIFHTSVLSSHSFVILVPHI 350 P C Y +F +++LS ++FV+ P++ Sbjct: 120 PRLSRLCIYVVFCSALLSHNAFVLARPNL 148 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 547,985 Number of Sequences: 2352 Number of extensions: 9295 Number of successful extensions: 39 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -