BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0988 (672 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003390-3|AAB54272.1| 1308|Caenorhabditis elegans Hypothetical ... 27 9.2 AC024770-1|AAF59482.1| 261|Caenorhabditis elegans Hypothetical ... 27 9.2 >AF003390-3|AAB54272.1| 1308|Caenorhabditis elegans Hypothetical protein R155.2 protein. Length = 1308 Score = 27.5 bits (58), Expect = 9.2 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -1 Query: 450 CSHLLPFDSIQKRTVCI-INDPVPKTLWNLFISITPPLSEQSSSI 319 C++++ D I++RT+CI D V T+ + +S L+ Q ++I Sbjct: 1097 CTNMVKVDGIERRTLCITFGDGVQLTVTHNLMSSWTYLNTQKTTI 1141 >AC024770-1|AAF59482.1| 261|Caenorhabditis elegans Hypothetical protein Y39H10A.4 protein. Length = 261 Score = 27.5 bits (58), Expect = 9.2 Identities = 17/59 (28%), Positives = 26/59 (44%) Frame = +2 Query: 278 WISGNAYXAASPSNMDELCSDSGGVILIKRFQRVLGTGSLIMQTVLFCIESNGRRWEQL 454 +I G+ Y SP+ CS G I R + V G G L + +E+ R W ++ Sbjct: 168 YIDGDIYSYESPALYPIQCSTPEGEIPTPRIEIVKGGGRLAVWLPPSVLEARCRMWVEV 226 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,985,158 Number of Sequences: 27780 Number of extensions: 380610 Number of successful extensions: 976 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 976 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -