BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0987 (677 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 23 1.7 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 23 1.7 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 23 1.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.0 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 23.4 bits (48), Expect = 1.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 157 RQPIPWARKVKYLGVTLDASMTFRPHIKSVRDR 255 RQ PW RKV G ++ TF P ++ R R Sbjct: 208 RQIYPWMRKVHVAGA---SNGTFAPGMEPKRQR 237 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 23.4 bits (48), Expect = 1.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 157 RQPIPWARKVKYLGVTLDASMTFRPHIKSVRDR 255 RQ PW RKV G ++ TF P ++ R R Sbjct: 208 RQIYPWMRKVHVAGA---SNGTFAPGMEPKRQR 237 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 23.4 bits (48), Expect = 1.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 157 RQPIPWARKVKYLGVTLDASMTFRPHIKSVRDR 255 RQ PW RKV G ++ TF P ++ R R Sbjct: 208 RQIYPWMRKVHVAGA---SNGTFAPGMEPKRQR 237 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 622 QSPSTP*TRPYGSIRS 669 Q P T+PYG+ RS Sbjct: 547 QQSQNPPTKPYGTCRS 562 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,610 Number of Sequences: 336 Number of extensions: 3297 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -