Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0986
         (474 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P02788 Cluster: Lactotransferrin precursor (EC 3.4.21.-...    32   7.4  

>UniRef50_P02788 Cluster: Lactotransferrin precursor (EC 3.4.21.-)
           (Lactoferrin) (Talalactoferrin alfa) [Contains:
           Kaliocin-1; Lactoferroxin A; Lactoferroxin B;
           Lactoferroxin C]; n=78; Amniota|Rep: Lactotransferrin
           precursor (EC 3.4.21.-) (Lactoferrin) (Talalactoferrin
           alfa) [Contains: Kaliocin-1; Lactoferroxin A;
           Lactoferroxin B; Lactoferroxin C] - Homo sapiens (Human)
          Length = 710

 Score = 31.9 bits (69), Expect = 7.4
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = -1

Query: 174 TELC*YGSLDKRLSLCLLCNVPAQGSNKCFPLFNKK 67
           ++ C  GS D R +LC LC    QG NKC P  N++
Sbjct: 509 SQSCAPGS-DPRSNLCALCIGDEQGENKCVPNSNER 543


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 339,942,595
Number of Sequences: 1657284
Number of extensions: 5509887
Number of successful extensions: 10656
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 10499
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10654
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 26450695845
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)