BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0985 (453 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 25 1.6 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 25 1.6 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 23 6.7 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 24.6 bits (51), Expect = 1.6 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -2 Query: 416 DTLRYKF*GLSIATTAVPPFKPKRITTSRQKSRRGGCTY 300 D R+ G+S +TTA+ R+TT +++ GC++ Sbjct: 386 DDFRHPCSGISGSTTAIGGSVFTRLTTVEEQNVSSGCSH 424 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 24.6 bits (51), Expect = 1.6 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -2 Query: 416 DTLRYKF*GLSIATTAVPPFKPKRITTSRQKSRRGGCTY 300 D R+ G+S +TTA+ R+TT +++ GC++ Sbjct: 386 DDFRHPCSGISGSTTAIGGSVFTRLTTVEEQNVSSGCSH 424 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 22.6 bits (46), Expect = 6.7 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 Query: 381 SYNGCTALQTETHYY 337 S N CT L THYY Sbjct: 215 SRNSCTQLWLITHYY 229 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 496,984 Number of Sequences: 2352 Number of extensions: 9882 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38694201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -