BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0983 (672 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1782.05 |||phosphotyrosyl phosphatase activator homolog|Schi... 26 5.7 SPBC3B8.09 |||U3 snoRNP-associated protein Utp3 |Schizosaccharom... 25 7.5 >SPAC1782.05 |||phosphotyrosyl phosphatase activator homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 352 Score = 25.8 bits (54), Expect = 5.7 Identities = 19/46 (41%), Positives = 22/46 (47%) Frame = +3 Query: 378 LYGSKWLIEL*QLSIYYCITCPVLSHFVFIITYVLSMLSLNFHITL 515 LY WL+ L QL I+ P L VF + YV M SL TL Sbjct: 143 LYFMSWLLILKQLGIFTKNDYPALVVRVF-VKYVELMRSLQIFYTL 187 >SPBC3B8.09 |||U3 snoRNP-associated protein Utp3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 597 Score = 25.4 bits (53), Expect = 7.5 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 190 SLKV*SLRLKEKINAITEY 134 SLKV ++ KEKINAI Y Sbjct: 16 SLKVPEIKEKEKINAINTY 34 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,267,086 Number of Sequences: 5004 Number of extensions: 40806 Number of successful extensions: 76 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -