BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0983 (672 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 3.8 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 24 3.8 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 3.8 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = +2 Query: 62 EDSYKSSEYDSL---SFFNANVLRTTSILSNGIY 154 +DSY + Y+ L +FF A+ + TS L NGIY Sbjct: 2164 QDSY-TPIYEGLISKTFFTAHWQKATSPLRNGIY 2196 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 337 TSCFYLRYSVSNCY*IDC 284 T CFY RY +C DC Sbjct: 5 TFCFYFRYKCYSCEPPDC 22 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 546,254 Number of Sequences: 2352 Number of extensions: 9243 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -