BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0981 (685 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4G9.17c |mrps5||mitochondrial ribosomal protein subunit S5|S... 27 2.5 SPBC1604.21c |ptr3|uba1, SPBC211.09|ubiquitin activating enzyme ... 27 3.3 SPAC1687.13c |csn5||COP9/signalosome complex subunit Csn5|Schizo... 26 5.8 >SPAC4G9.17c |mrps5||mitochondrial ribosomal protein subunit S5|Schizosaccharomyces pombe|chr 1|||Manual Length = 387 Score = 27.1 bits (57), Expect = 2.5 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -2 Query: 183 RAIKRKLYIPRNAHVDIYPAIHKCIMITT*TRRS 82 RA+K +YIPR +Y IHK T RS Sbjct: 280 RAVKNMVYIPRYDKRTVYGVIHKKFHAVRLTLRS 313 >SPBC1604.21c |ptr3|uba1, SPBC211.09|ubiquitin activating enzyme |Schizosaccharomyces pombe|chr 2|||Manual Length = 1012 Score = 26.6 bits (56), Expect = 3.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 360 KINKQKCSTHHQSFIRSCSNITSLNY 283 + K S HH FI + SN+ ++NY Sbjct: 809 EFEKDDDSNHHIDFITAASNLRAMNY 834 >SPAC1687.13c |csn5||COP9/signalosome complex subunit Csn5|Schizosaccharomyces pombe|chr 1|||Manual Length = 299 Score = 25.8 bits (54), Expect = 5.8 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = -2 Query: 429 DAGIPC*SYINKPVKYYHNSENTKINKQKCSTHHQSFIRSCS 304 DAG +Y + P+ Y+H+ K+ + + + I CS Sbjct: 199 DAGAHAEAYYSLPITYFHSKAEKKVTEFLRNRNWSRSITECS 240 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,440,423 Number of Sequences: 5004 Number of extensions: 45321 Number of successful extensions: 110 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -