BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0981 (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 6.8 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 6.8 AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 23 9.0 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +2 Query: 497 DPIAVADIHKIRRLSTIRMLTRVFTIDKKK 586 DPI + ++ K+R+ + +R L R+ T K+ Sbjct: 268 DPIVLLELCKLRKETELRRLERLSTQRTKR 297 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +2 Query: 497 DPIAVADIHKIRRLSTIRMLTRVFTIDKKK 586 DPI + ++ K+R+ + +R L R+ T K+ Sbjct: 268 DPIVLLELCKLRKETELRRLERLSTQRTKR 297 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 23.0 bits (47), Expect = 9.0 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -1 Query: 529 DFMDIGHSDWIL 494 DF D+G +DWI+ Sbjct: 286 DFSDVGWNDWIV 297 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 609,982 Number of Sequences: 2352 Number of extensions: 11229 Number of successful extensions: 53 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -