BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0978 (691 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 30 0.021 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 25 0.77 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 23 2.4 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 21 7.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.5 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 29.9 bits (64), Expect = 0.021 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = -3 Query: 278 SCESARVGPPPRLFLPXSSNAFRFEGRGSRCNYTETLELISQGGWR 141 S +A++G P + + N+ ++ G Y E +EL +GGW+ Sbjct: 271 SASNAKLGAPVK----GAGNSGKYTGEAGMLGYNEIVELQKEGGWK 312 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 24.6 bits (51), Expect = 0.77 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 221 NAFRFEGRGSRCNYTETLELISQGGWRT 138 +A R+ G Y E +E + GGW T Sbjct: 290 DAGRYTGERGMMGYNEIVEAQNAGGWTT 317 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/54 (20%), Positives = 23/54 (42%) Frame = +3 Query: 309 FKRVLSVKVNRFYRQRLDVCLWRLRHPWATVTLAIFYFDVWNRSHNYIVKGLSH 470 F + + ++ R +RQ+ + H + + L +W ++H Y K H Sbjct: 47 FSKAQTYELERRFRQQRYLSAPEREHLASIIRLTPTQVKIWFQNHRYKTKRAQH 100 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +3 Query: 105 WLLXPIDIYNVSAPPTLRYK 164 WL P + N P +LR+K Sbjct: 7 WLTPPHSLGNTVTPVSLRFK 26 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 675 QSKKETMYLAPLYY 634 Q K+T ++APLYY Sbjct: 1595 QWDKQTGHVAPLYY 1608 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,956 Number of Sequences: 336 Number of extensions: 3551 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -