BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0978 (691 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhy... 23 9.1 AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 pr... 23 9.1 >EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhydrase protein. Length = 255 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 412 FSILMYGIEVTIIL*KVYHIFKTGTHDCFAVNL 510 FS +E+ ++ + HI G DC A+NL Sbjct: 78 FSCEPAALELGCVVNNIKHIIVCGHSDCKAMNL 110 >AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 488 MIALR*I*HDGDNYPPVSTYN 550 MI + I HD DNYP Y+ Sbjct: 397 MIPVYAIHHDADNYPDPERYD 417 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 725,421 Number of Sequences: 2352 Number of extensions: 14773 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -