BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0978 (691 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006834-2|AAF40009.1| 562|Caenorhabditis elegans Acetylcholine... 29 3.1 Z81532-5|CAE17816.1| 101|Caenorhabditis elegans Hypothetical pr... 28 5.5 >AC006834-2|AAF40009.1| 562|Caenorhabditis elegans Acetylcholine receptor protein 6 protein. Length = 562 Score = 29.1 bits (62), Expect = 3.1 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 434 IPYIKIENSKCHGRPWVSQTPETHV 360 +P I + N+ HG PWVS+T + HV Sbjct: 89 LPDIILYNN-AHGSPWVSETTQVHV 112 >Z81532-5|CAE17816.1| 101|Caenorhabditis elegans Hypothetical protein F36F2.8 protein. Length = 101 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 337 TDFIGRGSTCVSGVCDTHGRP*HLLFSILMY 429 + F R C++G C+ H H LF MY Sbjct: 52 SQFCPRNFKCINGNCEKHNGSSHFLFGSAMY 82 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,804,362 Number of Sequences: 27780 Number of extensions: 325022 Number of successful extensions: 585 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 580 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 585 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1581836700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -