BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0976 (674 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 4.7 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 22 6.1 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 8.1 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 8.1 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 539 FQCDDRWPIDYSGVGLRS 486 F C RWP D +G+ RS Sbjct: 87 FCCGMRWPGDATGLSNRS 104 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 21.8 bits (44), Expect = 6.1 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -1 Query: 434 WLQLLQLACYVYHHW 390 W + QL CY+Y W Sbjct: 63 WPETRQLKCYMYCLW 77 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 8.1 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -1 Query: 341 DTISIPSVDHNIVNLVSDYAVYCVHW*CPVYSRRG 237 D+ S+P +D + +++ V V W V S G Sbjct: 309 DSNSLPFIDRTPIEIINSGDVQDVPWVTGVTSEEG 343 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 8.1 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -1 Query: 341 DTISIPSVDHNIVNLVSDYAVYCVHW*CPVYSRRG 237 D+ S+P +D + +++ V V W V S G Sbjct: 309 DSNSLPFIDRTPIEIINSGDVQDVPWVTGVTSEEG 343 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,371 Number of Sequences: 438 Number of extensions: 4476 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -