BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0974 (704 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR457148-1|CAG33429.1| 221|Homo sapiens LOC55974 protein. 52 3e-06 BC005943-1|AAH05943.1| 221|Homo sapiens recombination activatin... 52 3e-06 AL691442-9|CAI15324.1| 166|Homo sapiens recombination activatin... 52 3e-06 AL691442-8|CAI15323.1| 221|Homo sapiens recombination activatin... 52 3e-06 AL691442-6|CAI15321.1| 156|Homo sapiens recombination activatin... 52 3e-06 AF126024-1|AAF17233.1| 179|Homo sapiens stromal cell protein is... 52 3e-06 AF126023-1|AAF17232.1| 221|Homo sapiens stromal cell protein pr... 52 3e-06 BC009621-1|AAH09621.1| 167|Homo sapiens RAG1AP1 protein protein. 44 5e-04 AL691442-7|CAI15322.1| 167|Homo sapiens recombination activatin... 44 5e-04 AB065541-1|BAC05786.1| 312|Homo sapiens seven transmembrane hel... 30 7.0 >CR457148-1|CAG33429.1| 221|Homo sapiens LOC55974 protein. Length = 221 Score = 51.6 bits (118), Expect = 3e-06 Identities = 24/76 (31%), Positives = 42/76 (55%) Frame = +1 Query: 13 TAFMFYLIASPLFGLKEIIQNKSTEGMPFPIILSGTVVTFMWLLYGIILRNKFLVVQNVV 192 + F + SPL L ++IQ KST+ + +P+ ++ + + W LYG LR+ +++V N Sbjct: 134 SVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFP 193 Query: 193 ALVLCASQLSLFVIYP 240 +V + LF YP Sbjct: 194 GIVTSFIRFWLFWKYP 209 >BC005943-1|AAH05943.1| 221|Homo sapiens recombination activating gene 1 activating protein 1 protein. Length = 221 Score = 51.6 bits (118), Expect = 3e-06 Identities = 24/76 (31%), Positives = 42/76 (55%) Frame = +1 Query: 13 TAFMFYLIASPLFGLKEIIQNKSTEGMPFPIILSGTVVTFMWLLYGIILRNKFLVVQNVV 192 + F + SPL L ++IQ KST+ + +P+ ++ + + W LYG LR+ +++V N Sbjct: 134 SVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFP 193 Query: 193 ALVLCASQLSLFVIYP 240 +V + LF YP Sbjct: 194 GIVTSFIRFWLFWKYP 209 >AL691442-9|CAI15324.1| 166|Homo sapiens recombination activating gene 1 activating protein 1 protein. Length = 166 Score = 51.6 bits (118), Expect = 3e-06 Identities = 24/76 (31%), Positives = 42/76 (55%) Frame = +1 Query: 13 TAFMFYLIASPLFGLKEIIQNKSTEGMPFPIILSGTVVTFMWLLYGIILRNKFLVVQNVV 192 + F + SPL L ++IQ KST+ + +P+ ++ + + W LYG LR+ +++V N Sbjct: 79 SVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFP 138 Query: 193 ALVLCASQLSLFVIYP 240 +V + LF YP Sbjct: 139 GIVTSFIRFWLFWKYP 154 >AL691442-8|CAI15323.1| 221|Homo sapiens recombination activating gene 1 activating protein 1 protein. Length = 221 Score = 51.6 bits (118), Expect = 3e-06 Identities = 24/76 (31%), Positives = 42/76 (55%) Frame = +1 Query: 13 TAFMFYLIASPLFGLKEIIQNKSTEGMPFPIILSGTVVTFMWLLYGIILRNKFLVVQNVV 192 + F + SPL L ++IQ KST+ + +P+ ++ + + W LYG LR+ +++V N Sbjct: 134 SVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFP 193 Query: 193 ALVLCASQLSLFVIYP 240 +V + LF YP Sbjct: 194 GIVTSFIRFWLFWKYP 209 >AL691442-6|CAI15321.1| 156|Homo sapiens recombination activating gene 1 activating protein 1 protein. Length = 156 Score = 51.6 bits (118), Expect = 3e-06 Identities = 24/76 (31%), Positives = 42/76 (55%) Frame = +1 Query: 13 TAFMFYLIASPLFGLKEIIQNKSTEGMPFPIILSGTVVTFMWLLYGIILRNKFLVVQNVV 192 + F + SPL L ++IQ KST+ + +P+ ++ + + W LYG LR+ +++V N Sbjct: 69 SVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFP 128 Query: 193 ALVLCASQLSLFVIYP 240 +V + LF YP Sbjct: 129 GIVTSFIRFWLFWKYP 144 >AF126024-1|AAF17233.1| 179|Homo sapiens stromal cell protein isoform protein. Length = 179 Score = 51.6 bits (118), Expect = 3e-06 Identities = 24/76 (31%), Positives = 42/76 (55%) Frame = +1 Query: 13 TAFMFYLIASPLFGLKEIIQNKSTEGMPFPIILSGTVVTFMWLLYGIILRNKFLVVQNVV 192 + F + SPL L ++IQ KST+ + +P+ ++ + + W LYG LR+ +++V N Sbjct: 92 SVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFP 151 Query: 193 ALVLCASQLSLFVIYP 240 +V + LF YP Sbjct: 152 GIVTSFIRFWLFWKYP 167 >AF126023-1|AAF17232.1| 221|Homo sapiens stromal cell protein protein. Length = 221 Score = 51.6 bits (118), Expect = 3e-06 Identities = 24/76 (31%), Positives = 42/76 (55%) Frame = +1 Query: 13 TAFMFYLIASPLFGLKEIIQNKSTEGMPFPIILSGTVVTFMWLLYGIILRNKFLVVQNVV 192 + F + SPL L ++IQ KST+ + +P+ ++ + + W LYG LR+ +++V N Sbjct: 134 SVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFP 193 Query: 193 ALVLCASQLSLFVIYP 240 +V + LF YP Sbjct: 194 GIVTSFIRFWLFWKYP 209 >BC009621-1|AAH09621.1| 167|Homo sapiens RAG1AP1 protein protein. Length = 167 Score = 44.0 bits (99), Expect = 5e-04 Identities = 19/60 (31%), Positives = 35/60 (58%) Frame = +1 Query: 61 EIIQNKSTEGMPFPIILSGTVVTFMWLLYGIILRNKFLVVQNVVALVLCASQLSLFVIYP 240 ++IQ KST+ + +P+ ++ + + W LYG LR+ +++V N +V + LF YP Sbjct: 96 KVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWLFWKYP 155 >AL691442-7|CAI15322.1| 167|Homo sapiens recombination activating gene 1 activating protein 1 protein. Length = 167 Score = 44.0 bits (99), Expect = 5e-04 Identities = 19/60 (31%), Positives = 35/60 (58%) Frame = +1 Query: 61 EIIQNKSTEGMPFPIILSGTVVTFMWLLYGIILRNKFLVVQNVVALVLCASQLSLFVIYP 240 ++IQ KST+ + +P+ ++ + + W LYG LR+ +++V N +V + LF YP Sbjct: 96 KVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWLFWKYP 155 >AB065541-1|BAC05786.1| 312|Homo sapiens seven transmembrane helix receptor protein. Length = 312 Score = 30.3 bits (65), Expect = 7.0 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 4/77 (5%) Frame = +1 Query: 19 FMFYLIASPLFGLKEIIQNKSTEGMPFPIILSGTVVTFMWLLYGIILRNK----FLVVQN 186 F+ + S + L I+ K + P+ + FM L Y + K F+V +N Sbjct: 31 FLMIYVISVMGNLGMIVLTKLDSRLQTPMYFFLRHLAFMDLGYSTTVGPKMLVNFVVDKN 90 Query: 187 VVALVLCASQLSLFVIY 237 +++ CA+QL+ F+++ Sbjct: 91 IISYYFCATQLAFFLVF 107 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,182,745 Number of Sequences: 237096 Number of extensions: 2179198 Number of successful extensions: 4047 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3936 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4047 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8175213644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -