BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0973 (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23G3.08c |ubp7||ubiquitin C-terminal hydrolase Ubp7|Schizosa... 28 1.5 SPAC1834.02 |aro1||pentafunctional aromatic polypeptide Aro1 |Sc... 26 5.9 SPAC10F6.01c ||SPAC4C5.05c|sulfite reductase beta subunit |Schiz... 26 5.9 >SPAC23G3.08c |ubp7||ubiquitin C-terminal hydrolase Ubp7|Schizosaccharomyces pombe|chr 1|||Manual Length = 875 Score = 27.9 bits (59), Expect = 1.5 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -2 Query: 281 HHLNFCLNNSYFLPCQHTSDHS 216 + L C N Y C H SDHS Sbjct: 96 YELTLCANCGYLFCCNHESDHS 117 >SPAC1834.02 |aro1||pentafunctional aromatic polypeptide Aro1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1573 Score = 25.8 bits (54), Expect = 5.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 593 SRGFTSMHAVNNSFNLLRCKTDIPFL 516 S G +S+ V +LLRC T +P + Sbjct: 1094 SNGISSLDFVAEQISLLRCSTTLPII 1119 >SPAC10F6.01c ||SPAC4C5.05c|sulfite reductase beta subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 1473 Score = 25.8 bits (54), Expect = 5.9 Identities = 13/52 (25%), Positives = 22/52 (42%) Frame = -2 Query: 263 LNNSYFLPCQHTSDHS*ACHLPPRPKTSTWPPYGNLQHICSIPQHNHPSFEA 108 L N LP + + H+ H+P K GN++ P+ + P +A Sbjct: 191 LENIETLPSKEDAQHARVAHIPIEEKQEDSEKEGNIKEAFVPPKFDQPERDA 242 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,958,220 Number of Sequences: 5004 Number of extensions: 63092 Number of successful extensions: 153 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 153 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -