BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0971 (638 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0206 - 7771835-7771913,7772083-7772219,7772364-7772422,777... 28 5.4 10_08_0036 + 14325793-14326457,14326610-14328035 28 7.2 >02_02_0206 - 7771835-7771913,7772083-7772219,7772364-7772422, 7772535-7772610,7772717-7772873,7773241-7773329, 7773648-7773750,7773919-7774013,7774301-7774367, 7774894-7775066 Length = 344 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 194 LVLLEPRQEIVELCSPYLTLDWHYYWQMLHCL 99 +V+ + QE+V+ C YLT++W + CL Sbjct: 139 VVMCDIDQEVVDFCRTYLTVNWDAFASDKLCL 170 >10_08_0036 + 14325793-14326457,14326610-14328035 Length = 696 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 542 QPTFVPRSLELKFD*TVLLRTY 477 +PTF +LE+ FD TV LR Y Sbjct: 245 EPTFTAMALEINFDFTVELRKY 266 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,628,155 Number of Sequences: 37544 Number of extensions: 168468 Number of successful extensions: 434 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -