BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0971 (638 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 23 2.5 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 23 3.3 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.8 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.8 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 23.0 bits (47), Expect = 2.5 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +2 Query: 26 VSQLTNIENIIAETAPDLERAKAL 97 + QLT + N + E P+L K++ Sbjct: 95 IEQLTKLNNAVEEKRPELTNRKSV 118 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +2 Query: 26 VSQLTNIENIIAETAPDLERAKAL 97 + QLT + N + E P+L K + Sbjct: 217 IEQLTKLNNAVEEKRPELTNRKGV 240 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 5.8 Identities = 20/75 (26%), Positives = 27/75 (36%), Gaps = 1/75 (1%) Frame = -2 Query: 427 FCTINNIICFVFXLLPRRFQSLKYLFVNAKVVIVGXXXXXXXXXXXXXLVQSLMLLELIT 248 FCT+ I PR + K LF+ A V V V LL+ Sbjct: 393 FCTVEGFITAAVDEWPRLLRKRKELFI-AIVCFVSYLIGLFCITEGGMYV--FQLLDSYA 449 Query: 247 FRGF-YIAIRFFYCV 206 GF + + FF C+ Sbjct: 450 VSGFCLLFLMFFECI 464 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 5.8 Identities = 20/75 (26%), Positives = 27/75 (36%), Gaps = 1/75 (1%) Frame = -2 Query: 427 FCTINNIICFVFXLLPRRFQSLKYLFVNAKVVIVGXXXXXXXXXXXXXLVQSLMLLELIT 248 FCT+ I PR + K LF+ A V V V LL+ Sbjct: 446 FCTVEGFITAAVDEWPRLLRKRKELFI-AIVCFVSYLIGLFCITEGGMYV--FQLLDSYA 502 Query: 247 FRGF-YIAIRFFYCV 206 GF + + FF C+ Sbjct: 503 VSGFCLLFLMFFECI 517 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,384 Number of Sequences: 438 Number of extensions: 2013 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -