SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0970
         (685 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    23   3.1  
EF127810-1|ABL67947.1|  311|Tribolium castaneum nicotinic acetyl...    21   9.4  
EF127809-1|ABL67946.1|  311|Tribolium castaneum nicotinic acetyl...    21   9.4  
EF127808-1|ABL67945.1|  311|Tribolium castaneum nicotinic acetyl...    21   9.4  
EF127807-1|ABL67944.1|  311|Tribolium castaneum nicotinic acetyl...    21   9.4  
EF127806-1|ABL67943.1|  311|Tribolium castaneum nicotinic acetyl...    21   9.4  
AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.    21   9.4  
AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.    21   9.4  

>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 22.6 bits (46), Expect = 3.1
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +3

Query: 222 GQEIAEQLVNL*SREHSRLC 281
           G++  EQ+V++  R H +LC
Sbjct: 505 GKKSEEQIVDICIRSHDKLC 524


>EF127810-1|ABL67947.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           5 protein.
          Length = 311

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -1

Query: 664 GTYQTNLSTKH 632
           GT+QTN+  KH
Sbjct: 102 GTFQTNVVVKH 112


>EF127809-1|ABL67946.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           4 protein.
          Length = 311

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -1

Query: 664 GTYQTNLSTKH 632
           GT+QTN+  KH
Sbjct: 102 GTFQTNVVVKH 112


>EF127808-1|ABL67945.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           3 protein.
          Length = 311

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -1

Query: 664 GTYQTNLSTKH 632
           GT+QTN+  KH
Sbjct: 102 GTFQTNVVVKH 112


>EF127807-1|ABL67944.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           2 protein.
          Length = 311

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -1

Query: 664 GTYQTNLSTKH 632
           GT+QTN+  KH
Sbjct: 102 GTFQTNVVVKH 112


>EF127806-1|ABL67943.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           1 protein.
          Length = 311

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -1

Query: 664 GTYQTNLSTKH 632
           GT+QTN+  KH
Sbjct: 102 GTFQTNVVVKH 112


>AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.
          Length = 712

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 11/33 (33%), Positives = 14/33 (42%)
 Frame = -2

Query: 630 FTHQTNTYIHFLGARSKTCTFNKINILIDH*IC 532
           + H T      LGA  + CT N  N +  H  C
Sbjct: 122 YYHFTLELYTVLGAACQVCTPNATNTVWSHCQC 154


>AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.
          Length = 717

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 11/33 (33%), Positives = 14/33 (42%)
 Frame = -2

Query: 630 FTHQTNTYIHFLGARSKTCTFNKINILIDH*IC 532
           + H T      LGA  + CT N  N +  H  C
Sbjct: 122 YYHFTLELYTVLGAACQVCTPNATNTVWSHCQC 154


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 123,055
Number of Sequences: 336
Number of extensions: 2158
Number of successful extensions: 10
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17906060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -