BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0968 (640 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_4086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_15834| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_24443| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3306 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 49 VFNQIRVMTEPTAQPSLTCADIRSEIR 129 + Q R +TE T +PS+TCA++ IR Sbjct: 336 ICEQKRYLTELTIEPSVTCAELTEYIR 362 >SB_4086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2235 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -3 Query: 599 LLVLNLVDSKISATIHSLMSWFTALMPCNSTVAIGLKTIRVGTT 468 ++ L++ + S+ IHS+ SW TA +A LK +R T+ Sbjct: 853 MVSLSVATTPYSSWIHSVFSWMTASTSATDPIA-SLKPLRFATS 895 >SB_15834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 647 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -3 Query: 236 AFTLLWRTTTSILICIMFFLLYFEHVQTRHASE 138 AF++ + TTT ++ + F+++ HVQ R SE Sbjct: 449 AFSVGFETTTHTILWFIVFMIHNPHVQARCQSE 481 >SB_24443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 481 VSELPTRHDRSIIAIEVSLQICTCLNFLQ*LVTC 380 V+ P H +I + +CTC N Q ++ C Sbjct: 94 VNTRPNVHQNDVIVVNTRPNVCTCNNSCQQMLLC 127 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,650,632 Number of Sequences: 59808 Number of extensions: 401610 Number of successful extensions: 861 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 861 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -