BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0967 (608 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) 30 1.3 SB_15319| Best HMM Match : Transposase_9 (HMM E-Value=3.2) 30 1.3 SB_13174| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_36107| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) 30 1.7 SB_24180| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_49747| Best HMM Match : RVT_1 (HMM E-Value=2.1e-36) 30 1.7 SB_46950| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) 30 1.7 SB_45147| Best HMM Match : zf-CCHC (HMM E-Value=0.0051) 30 1.7 SB_32803| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_23788| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) 30 1.7 SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 30 1.7 SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) 30 1.7 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 29 2.2 SB_24050| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_20046| Best HMM Match : UPAR_LY6 (HMM E-Value=3.2) 29 2.9 SB_47225| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_44616| Best HMM Match : rve (HMM E-Value=0.012) 28 5.1 SB_24712| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_20652| Best HMM Match : OmpH (HMM E-Value=1.9) 28 5.1 SB_19217| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_12593| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_56854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_50077| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_2018| Best HMM Match : AIRC (HMM E-Value=5.1) 28 5.1 SB_47005| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_38639| Best HMM Match : Avirulence (HMM E-Value=1.5) 28 6.8 SB_51519| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_30231| Best HMM Match : POPLD (HMM E-Value=2.5) 28 6.8 SB_12700| Best HMM Match : POPLD (HMM E-Value=1.9) 28 6.8 SB_41555| Best HMM Match : CXC (HMM E-Value=3.9) 27 9.0 SB_33327| Best HMM Match : Tombus_movement (HMM E-Value=3.5) 27 9.0 SB_32960| Best HMM Match : Ribonuc_red_sm (HMM E-Value=0) 27 9.0 SB_24296| Best HMM Match : Pox_A32 (HMM E-Value=1) 27 9.0 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_20133| Best HMM Match : Extensin_2 (HMM E-Value=2.1) 27 9.0 SB_7748| Best HMM Match : DUF229 (HMM E-Value=4.5e-10) 27 9.0 SB_57058| Best HMM Match : ROKNT (HMM E-Value=8) 27 9.0 SB_54540| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=2.2) 27 9.0 SB_40686| Best HMM Match : rve (HMM E-Value=0.00016) 27 9.0 SB_39617| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) 27 9.0 SB_16103| Best HMM Match : RVP (HMM E-Value=0.027) 27 9.0 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_2786| Best HMM Match : Pox_A32 (HMM E-Value=0.11) 27 9.0 SB_1252| Best HMM Match : POPLD (HMM E-Value=1.9) 27 9.0 >SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) Length = 1566 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/77 (24%), Positives = 33/77 (42%) Frame = -3 Query: 375 HQQRGDPEGSQEAYCQEQKIRKEPSPCLCCRMDRRKQRAGRESTFSTSRQHESFRHVTEL 196 +Q D E + +IR++ R++ R+ RE+ RQ E RHV E Sbjct: 103 YQHIRDYEADKRRLADSIEIRRQEQAKTLEEKKRQRLRS-REAAMEEKRQKERLRHVQEA 161 Query: 195 FRHIKRYFSFVEHLHNF 145 H++ + V+ L + Sbjct: 162 SLHLRSHQDDVKRLDGY 178 >SB_15319| Best HMM Match : Transposase_9 (HMM E-Value=3.2) Length = 782 Score = 30.3 bits (65), Expect = 1.3 Identities = 25/94 (26%), Positives = 40/94 (42%) Frame = +3 Query: 237 Y*RWIPFQLFVFVYPFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIF 416 Y W P QL + V PF KG P++ + + F + R N D+F Sbjct: 341 YGYW-PQQLNLAVCPFTQKGN---PYKKAAFERLCIEFGMSRKPDFRWKGGRNHGLGDVF 396 Query: 417 IYHEGERFPYKFNIPSYDTQSNVVPKN*I*ITDE 518 +++ GE + I YDT ++ P + +DE Sbjct: 397 VFYPGEGYRNVHVIRGYDTAADEYPSHLNLFSDE 430 >SB_13174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1108 Score = 30.3 bits (65), Expect = 1.3 Identities = 21/80 (26%), Positives = 34/80 (42%) Frame = +3 Query: 279 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 458 PF KG P++ + + F L R N D+F+++ GE + I Sbjct: 155 PFTQKGN---PYKKAAFERLCIEFGLPRKPDFRWKGGRNHGLDDVFVFYPGEGYRNMHVI 211 Query: 459 PSYDTQSNVVPKN*I*ITDE 518 P YDT ++ P + +DE Sbjct: 212 PGYDTAADEYPSHLNLFSDE 231 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL G+N + + E Sbjct: 219 SWLRLFKLDWPSMKLVEGKNTALSDLTE 246 >SB_36107| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) Length = 425 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL G+N + + E Sbjct: 377 SWLRLFKLDWPSIKLVQGKNTALSDLTE 404 >SB_24180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL G+N + + E Sbjct: 76 SWLRLFKLDWPSIKLVQGKNTALSDLTE 103 >SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2309 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL G+N + + E Sbjct: 293 SWLRLFKLDWPSIKLVQGKNTALSDLTE 320 >SB_49747| Best HMM Match : RVT_1 (HMM E-Value=2.1e-36) Length = 877 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL G+N + + E Sbjct: 76 SWLRLFKLDWPSIKLVQGKNTALSDLTE 103 >SB_46950| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) Length = 797 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL G+N + + E Sbjct: 287 SWLRLFKLDWPSIKLVQGKNTALSDLTE 314 >SB_45147| Best HMM Match : zf-CCHC (HMM E-Value=0.0051) Length = 522 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL G+N + + E Sbjct: 164 SWLRLFKLDWPSIKLVQGKNTALSDLTE 191 >SB_32803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL G+N + + E Sbjct: 15 SWLRLFKLDWPSIKLVQGKNTALSDLTE 42 >SB_23788| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) Length = 1122 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL G+N + + E Sbjct: 399 SWLRLFKLDWPSIKLVQGKNTALSDLTE 426 >SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1696 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL G+N + + E Sbjct: 467 SWLRLFKLDWPSIKLVQGKNTALSDLTE 494 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL G+N + + E Sbjct: 1117 SWLRLFKLDWPSIKLVQGKNTALSDLTE 1144 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL G+N + + E Sbjct: 143 SWLRLFKLDWPSMKLVEGKNTALSDLTE 170 >SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) Length = 1217 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL G+N + + E Sbjct: 176 SWLRLFKLDWPSIKLVQGKNTALSDLTE 203 >SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) Length = 889 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -3 Query: 285 RMDRRKQRAGRESTFSTSRQHESFRHVTELFRHIKRYFSFVEHL 154 +M RR + R + S HES RH E +R I Y + ++ L Sbjct: 463 KMYRRTHKRYRRTHESYRHTHESHRHTHESYRRIHAYSTVIDIL 506 >SB_24050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 29.5 bits (63), Expect = 2.2 Identities = 22/80 (27%), Positives = 34/80 (42%) Frame = +3 Query: 279 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 458 PF KGK P++ + + F L R L N D+F+++ GE + I Sbjct: 203 PFTQKGK---PYKKAAFERLCIEFGLPRKPDFRLKGGRNHGLGDVFVFYPGEGYRNVHVI 259 Query: 459 PSYDTQSNVVPKN*I*ITDE 518 YDT + P + +DE Sbjct: 260 RGYDTAMDEYPSHLNLFSDE 279 >SB_20046| Best HMM Match : UPAR_LY6 (HMM E-Value=3.2) Length = 419 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL G+N + + E Sbjct: 349 SWLRLFKLDWPSIKLVQGKNIALSDLTE 376 >SB_47225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 28.7 bits (61), Expect = 3.9 Identities = 21/80 (26%), Positives = 34/80 (42%) Frame = +3 Query: 279 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 458 PF KG P++ + + F L R N D+F+++ GER+ I Sbjct: 186 PFTQKGN---PYKKAAFERLCIEFGLPRKPDFRWKGGRNHGLGDVFVFYPGERYRNVHVI 242 Query: 459 PSYDTQSNVVPKN*I*ITDE 518 YDT ++ P + +DE Sbjct: 243 RGYDTAADEYPSHLNLFSDE 262 >SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1228 Score = 28.3 bits (60), Expect = 5.1 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+L+W + KL G+N + + E Sbjct: 344 SWLRLFKLEWPSIKLVQGKNTALSDLTE 371 Score = 28.3 bits (60), Expect = 5.1 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+L+W + KL G+N + + E Sbjct: 827 SWLRLFKLEWPSIKLVQGKNTALSDLTE 854 >SB_44616| Best HMM Match : rve (HMM E-Value=0.012) Length = 1189 Score = 28.3 bits (60), Expect = 5.1 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 1/88 (1%) Frame = +3 Query: 237 Y*RWIPFQLFVFVYPFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFK-DI 413 Y W P QL V PF KG P++ + + F L R D +K + D+ Sbjct: 375 YGYW-PQQLNFAVCPFTQKGN---PYKKAAFERLCIEFSLPRKP-DFRWKGGRNHGPGDV 429 Query: 414 FIYHEGERFPYKFNIPSYDTQSNVVPKN 497 F+++ GE + I YDT ++ P + Sbjct: 430 FVFYPGEGYRNVHVILGYDTAADEYPSH 457 >SB_24712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 28.3 bits (60), Expect = 5.1 Identities = 21/80 (26%), Positives = 35/80 (43%) Frame = +3 Query: 279 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 458 PF KG P++ + + F L R + N D+F+++ GE + I Sbjct: 179 PFTQKGN---PYKKAAFERLCIEFGLPRKLDFRWKGGRNHGLGDVFVFYPGEGYRNVHVI 235 Query: 459 PSYDTQSNVVPKN*I*ITDE 518 SYDT ++ P + +DE Sbjct: 236 CSYDTAADEYPSHLNLFSDE 255 >SB_20652| Best HMM Match : OmpH (HMM E-Value=1.9) Length = 842 Score = 28.3 bits (60), Expect = 5.1 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 3/83 (3%) Frame = +3 Query: 279 PFDNKGKDL--APFESFVLD-NKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYK 449 PF KG A FE ++ P G P++R N D+F+++ GER Sbjct: 132 PFTQKGNPYKKAAFERLCIEFGLPPGLPMERR--------RNHGLGDVFVFYPGERCRNV 183 Query: 450 FNIPSYDTQSNVVPKN*I*ITDE 518 I YDT ++ P + +DE Sbjct: 184 HVIRGYDTAADKYPSHPNLFSDE 206 >SB_19217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 28.3 bits (60), Expect = 5.1 Identities = 25/87 (28%), Positives = 36/87 (41%) Frame = +3 Query: 237 Y*RWIPFQLFVFVYPFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIF 416 Y W P QL V PF KG P++ V + + F L R N D+F Sbjct: 237 YGYW-PQQLNFAVCPFTQKGN---PYKKAVFERLCIEFGLPRNPDFRWKGGRNHGLGDVF 292 Query: 417 IYHEGERFPYKFNIPSYDTQSNVVPKN 497 +++ GE I YDT ++ P + Sbjct: 293 VFYPGEGNRNVHVIRGYDTAADEYPSH 319 >SB_12593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 408 DIFIYHEGERFPYKFNIPSYDTQSNVVPKN*I*ITDE 518 D+F+++ GE + IP YDT ++ P + +DE Sbjct: 259 DVFVFYPGEGYRNVHVIPGYDTAADEYPSHINLFSDE 295 >SB_56854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +1 Query: 358 IAPLLMHYSRFLTCISRIFSFTTRVNGSLTNSIFLRMTHS 477 I PL+ L C+S + T ++GSL++ + ++TH+ Sbjct: 45 ILPLVPRPKELLECVSNMRLLTWLLHGSLSHMVHSKITHA 84 >SB_50077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 907 Score = 28.3 bits (60), Expect = 5.1 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 3/83 (3%) Frame = +3 Query: 279 PFDNKGKDL--APFESFVLD-NKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYK 449 PF KG A FE ++ P G P++R L D+F+++ GE + Sbjct: 128 PFTQKGNPYKKAAFERLCIEFGLPPGLPMERRAEHGL--------GDVFVFYPGEGYRNV 179 Query: 450 FNIPSYDTQSNVVPKN*I*ITDE 518 I YDT ++ P + +DE Sbjct: 180 HVIRGYDTAADEYPSHLNLFSDE 202 >SB_2018| Best HMM Match : AIRC (HMM E-Value=5.1) Length = 298 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 408 DIFIYHEGERFPYKFNIPSYDTQSNVVPKN*I*ITDE 518 D+F+++ GE + IP YDT ++ P + +DE Sbjct: 253 DVFVFYPGEGYRNVHVIPGYDTAADEYPSHINLFSDE 289 >SB_47005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 289 Score = 27.9 bits (59), Expect = 6.8 Identities = 19/73 (26%), Positives = 31/73 (42%) Frame = +3 Query: 279 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 458 PF KG P++ + + F L R V N D+F+++ GE + I Sbjct: 177 PFTQKGN---PYKKAAFERLCIEFGLPRKQVFRWKGGRNHGLGDVFVFYPGEGYCNVHVI 233 Query: 459 PSYDTQSNVVPKN 497 YDT ++ P + Sbjct: 234 RGYDTAADEYPSH 246 >SB_38639| Best HMM Match : Avirulence (HMM E-Value=1.5) Length = 546 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 255 RESTFSTSRQHESFRHVTELFRHI 184 R + + S +HES RH TEL +HI Sbjct: 523 RYNNHTASFRHESKRHTTELSKHI 546 >SB_51519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 255 RESTFSTSRQHESFRHVTELFRHI 184 R + + S +HES RH TEL +HI Sbjct: 154 RYNNHTASFRHESKRHTTELSKHI 177 >SB_30231| Best HMM Match : POPLD (HMM E-Value=2.5) Length = 181 Score = 27.9 bits (59), Expect = 6.8 Identities = 21/80 (26%), Positives = 34/80 (42%) Frame = +3 Query: 279 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 458 PF KG P++ + + F L R V N D+F+++ GE + I Sbjct: 48 PFTQKGN---PYKKAAFERLCIEFGLPRKPDFRWKGVRNNGLGDVFVFYPGEGYRNVRVI 104 Query: 459 PSYDTQSNVVPKN*I*ITDE 518 YDT ++ P + +DE Sbjct: 105 RGYDTAADEYPSHLNLFSDE 124 >SB_12700| Best HMM Match : POPLD (HMM E-Value=1.9) Length = 461 Score = 27.9 bits (59), Expect = 6.8 Identities = 20/80 (25%), Positives = 34/80 (42%) Frame = +3 Query: 279 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 458 PF KG P++ + + F L R N + D+F+++ GE + I Sbjct: 267 PFTQKGN---PYKKAAFERLCIEFGLPRKPDFRWKGGRNHWLGDVFVFYPGEGYRNVHVI 323 Query: 459 PSYDTQSNVVPKN*I*ITDE 518 YDT ++ P + +DE Sbjct: 324 RGYDTAADEYPSHLNLFSDE 343 >SB_41555| Best HMM Match : CXC (HMM E-Value=3.9) Length = 607 Score = 27.5 bits (58), Expect = 9.0 Identities = 20/80 (25%), Positives = 34/80 (42%) Frame = +3 Query: 279 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 458 PF KG P++ + + F L R N D+F+++ G+R+ I Sbjct: 288 PFTQKGN---PYKKAAFERLCIEFGLPRKPDFRWKGGRNQGLGDMFVFYPGDRYRNVHVI 344 Query: 459 PSYDTQSNVVPKN*I*ITDE 518 YDT ++ P + +DE Sbjct: 345 RGYDTAADEYPSHLNLFSDE 364 >SB_33327| Best HMM Match : Tombus_movement (HMM E-Value=3.5) Length = 527 Score = 27.5 bits (58), Expect = 9.0 Identities = 20/80 (25%), Positives = 34/80 (42%) Frame = +3 Query: 279 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 458 PF KG P++ + + F L R N D+F+++ GE + + I Sbjct: 288 PFTKKGN---PYKKAAFERLCIEFGLPRKPDFRWKGGRNHGLGDVFVFYPGEGYRNVYVI 344 Query: 459 PSYDTQSNVVPKN*I*ITDE 518 YDT ++ P + +DE Sbjct: 345 RGYDTAADEYPSHLNLFSDE 364 >SB_32960| Best HMM Match : Ribonuc_red_sm (HMM E-Value=0) Length = 991 Score = 27.5 bits (58), Expect = 9.0 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 1/81 (1%) Frame = +3 Query: 279 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMY-FKDIFIYHEGERFPYKFN 455 PF KG P++ + + F L R D +K Y D+F+++ GE + Sbjct: 705 PFTQKGN---PYKKAAFERLCIEFGLPRKP-DFRWKGGRNYGLGDVFVFYPGEGYRNVHV 760 Query: 456 IPSYDTQSNVVPKN*I*ITDE 518 I YDT ++ P + +DE Sbjct: 761 IRGYDTAADEYPSHLNLFSDE 781 >SB_24296| Best HMM Match : Pox_A32 (HMM E-Value=1) Length = 1041 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 408 DIFIYHEGERFPYKFNIPSYDTQSNVVPKN*I*ITDE 518 D+F+++ GER+ I YDT ++ P + +DE Sbjct: 499 DVFVFYPGERYRNVHVIRGYDTAADEYPSHLNRFSDE 535 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = -3 Query: 381 IMHQQRGDPEGSQEAYCQEQKIRKEPSPCLCCRMDRRKQRA 259 ++HQ++ E Q++ C E+++ +E + L C + KQRA Sbjct: 1623 LLHQEKLLKEKQQQSACVEKQVEQELA-LLRCELAEAKQRA 1662 >SB_20133| Best HMM Match : Extensin_2 (HMM E-Value=2.1) Length = 762 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 121 KEDSVPMTEIMKMLDEGKVPFDMSEEFCYMPKRLMLPRGTEGG 249 K++ TE LDE K D+ E Y K+ +P+GT+ G Sbjct: 592 KKEVSAATESKDALDETKKCKDLPVENAYENKKNYVPQGTQAG 634 >SB_7748| Best HMM Match : DUF229 (HMM E-Value=4.5e-10) Length = 784 Score = 27.5 bits (58), Expect = 9.0 Identities = 21/50 (42%), Positives = 23/50 (46%) Frame = +3 Query: 216 KTHAA*RY*RWIPFQLFVFVYPFDNKGKDLAPFESFVLDNKPLGFPLDRP 365 +T AA R RW FQ V Y DN G L F VL+ P DRP Sbjct: 314 RTSAAYRK-RWRAFQELVNTYNIDNYG--LTHFSCEVLNQYGYTNPYDRP 360 >SB_57058| Best HMM Match : ROKNT (HMM E-Value=8) Length = 200 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = +1 Query: 55 FTTKLTAGQNKIIRNSNEFVIFKEDSVPMTEIMKMLDEGKVP 180 + K TA +K ++NE +E+ +P+ + + D+ VP Sbjct: 142 YNDKSTAHNDKRTTDNNESTAVREEKIPLPCVASLFDQTAVP 183 >SB_54540| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=2.2) Length = 558 Score = 27.5 bits (58), Expect = 9.0 Identities = 21/80 (26%), Positives = 33/80 (41%) Frame = +3 Query: 279 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 458 PF KG P++ + + F L R N D+F+++ GE + I Sbjct: 242 PFAQKGN---PYKKAAFERLCIEFGLPREPDFRWKGGRNHGLGDVFVFYPGEGYRNVHVI 298 Query: 459 PSYDTQSNVVPKN*I*ITDE 518 YDT ++ P N +DE Sbjct: 299 RGYDTAADEYPSNLNLFSDE 318 >SB_40686| Best HMM Match : rve (HMM E-Value=0.00016) Length = 1586 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 408 DIFIYHEGERFPYKFNIPSYDTQSNVVPKN*I*ITDE 518 D+F+++ GER+ I YDT ++ P + +DE Sbjct: 158 DVFVFYPGERYRNVHVIRGYDTAADEYPSHINMFSDE 194 >SB_39617| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) Length = 1084 Score = 27.5 bits (58), Expect = 9.0 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL +N + + E Sbjct: 365 SWLRLFKLDWPSIKLVQSKNTALSDLTE 392 >SB_16103| Best HMM Match : RVP (HMM E-Value=0.027) Length = 274 Score = 27.5 bits (58), Expect = 9.0 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 25 NWMKFFELDWFTTKLTAGQNKIIRNSNE 108 +W++ F+LDW + KL +N + + E Sbjct: 135 SWLRLFKLDWPSIKLVQSKNTALSDLTE 162 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 27.5 bits (58), Expect = 9.0 Identities = 20/80 (25%), Positives = 34/80 (42%) Frame = +3 Query: 279 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 458 PF KG P++ + + F L R N D+F+++ GE + + I Sbjct: 833 PFTKKGN---PYKKAAFERLCIEFGLPRKPDFRWKGGRNHGLGDVFVFYPGEGYRNVYVI 889 Query: 459 PSYDTQSNVVPKN*I*ITDE 518 YDT ++ P + +DE Sbjct: 890 RGYDTAADEYPSHLNLFSDE 909 >SB_2786| Best HMM Match : Pox_A32 (HMM E-Value=0.11) Length = 1182 Score = 27.5 bits (58), Expect = 9.0 Identities = 20/80 (25%), Positives = 34/80 (42%) Frame = +3 Query: 279 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 458 PF KG P++ + + F L R N D+F+++ G+R+ I Sbjct: 43 PFTQKGN---PYKKAAFERLCIEFGLPRKPDFRWKGGRNQGLGDMFVFYPGDRYRNVHVI 99 Query: 459 PSYDTQSNVVPKN*I*ITDE 518 YDT ++ P + +DE Sbjct: 100 RGYDTAADEYPSHLNLFSDE 119 >SB_1252| Best HMM Match : POPLD (HMM E-Value=1.9) Length = 566 Score = 27.5 bits (58), Expect = 9.0 Identities = 21/80 (26%), Positives = 33/80 (41%) Frame = +3 Query: 279 PFDNKGKDLAPFESFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIFIYHEGERFPYKFNI 458 PF KG P++ + + F L R N D+F+++ GE + I Sbjct: 414 PFTQKGN---PYKKAAFERLCIEFGLPRKPHFRWKGGRNHGLGDVFVFYPGEGYRNVHVI 470 Query: 459 PSYDTQSNVVPKN*I*ITDE 518 YDT ++ P + TDE Sbjct: 471 RGYDTAADEYPSHLNLFTDE 490 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,010,345 Number of Sequences: 59808 Number of extensions: 393381 Number of successful extensions: 1291 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 1202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1288 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -