BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0966 (699 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 25 0.91 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.1 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 23 3.7 M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 23 3.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 4.9 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 8.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 8.5 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 24.6 bits (51), Expect = 0.91 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -1 Query: 462 LPEPSAGATCSRWQVKCRSDGXGNGCSPRPARRT 361 +PEPS WQ+ C + CSP P R+T Sbjct: 373 IPEPSKNPAMGHWQMSCVA------CSP-PPRQT 399 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 410 RHFTCHRLQVAPALGSGRCRRSSGPPAHSA 499 +HF H++QV+ + G R S HSA Sbjct: 916 QHFPHHQIQVSTSAGLQTIRLSGHSVLHSA 945 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -1 Query: 234 RTVHPKGERGLHRAIFSPSP 175 R PK E G +R I+ P P Sbjct: 62 REAEPKAEPGNNRPIYIPQP 81 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 411 RSDGXGNGCSPRPAR 367 RSDG GNG +P R Sbjct: 8 RSDGRGNGGTPEEKR 22 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 86 QGEVNRKGRGSAGNLSWITYXXSPRPSPQRGEGE 187 +G V R+ GSA N+ ++ P P P R + Sbjct: 1837 RGSVGRRSVGSARNIP-VSGSPEPPPPPPRNHDQ 1869 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 631 KRRPVNCNTTHYRANWVPGP 572 K++P +C+T YR V P Sbjct: 565 KKQPSDCDTLEYRNGEVTTP 584 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 8.5 Identities = 11/41 (26%), Positives = 17/41 (41%) Frame = +2 Query: 128 LSWITYXXSPRPSPQRGEGEKMARCSPLSPLGCTVRGHSEH 250 +SW+ SP P P +++ P S L +EH Sbjct: 643 ISWLKDGQSPFPLPPNLASANISQLDPYSSLLSITNLAAEH 683 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 225,770 Number of Sequences: 438 Number of extensions: 6127 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -