BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0963 (617 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93785-3|CAB07857.1| 173|Caenorhabditis elegans Hypothetical pr... 78 6e-15 AL132858-15|CAB60482.3| 300|Caenorhabditis elegans Hypothetical... 27 8.1 >Z93785-3|CAB07857.1| 173|Caenorhabditis elegans Hypothetical protein W09D10.3 protein. Length = 173 Score = 77.8 bits (183), Expect = 6e-15 Identities = 34/57 (59%), Positives = 46/57 (80%) Frame = +3 Query: 339 SFTVKMTKFDDKQKVALIKEVKGLLEGFNLVQAKKFVESVPTVVKADISKDEAEKLK 509 +FTVK+TKFDD +K+A+IKE++ + G NLVQAKKFVE+ P VK D+ K EA++LK Sbjct: 104 TFTVKLTKFDDTKKIAIIKEIRNAIPGLNLVQAKKFVETAPVNVKEDLGKAEADELK 160 Score = 50.4 bits (115), Expect = 1e-06 Identities = 24/47 (51%), Positives = 34/47 (72%) Frame = +1 Query: 121 PVPEGVDKPVSPKIEKIVFEITNLNLLEVSELSQVLKKRLNLPDAQL 261 P+P D+ +S K+ +V EI NL+LL+VS+L+ LKKRLN+PD L Sbjct: 34 PLPSE-DRAISAKVSSLVEEIANLSLLDVSDLNWALKKRLNIPDQPL 79 >AL132858-15|CAB60482.3| 300|Caenorhabditis elegans Hypothetical protein Y113G7A.10 protein. Length = 300 Score = 27.5 bits (58), Expect = 8.1 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 5/63 (7%) Frame = -1 Query: 356 HFNCKTGLHSFRG---CLFFINSSRWSHCESAHWHNWASGRFNLFFNT*L--SSDTSKRF 192 H N K+ H F+ +F + W+ C S H NW + F FF + +S+ R Sbjct: 92 HINSKSYTHCFKSPNPFVFLELPNGWACCCSGHNCNWHNPSFFQFFERFILDNSELFNRL 151 Query: 191 KLV 183 K V Sbjct: 152 KAV 154 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,773,281 Number of Sequences: 27780 Number of extensions: 221864 Number of successful extensions: 811 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1342816466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -