Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0961
         (670 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC2G11.02 |urb2||ribosome biogenesis protein Urb2 |Schizosacch...    25   7.5  

>SPAC2G11.02 |urb2||ribosome biogenesis protein Urb2
            |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1318

 Score = 25.4 bits (53), Expect = 7.5
 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%)
 Frame = -2

Query: 498  LYSNINXFIIHSKHSVHVFLLRCNHKF-NQS 409
            +++N +     ++H VH+ LL C H F NQ+
Sbjct: 1054 VFANYSDCFQRNRHLVHMVLLCCTHVFYNQT 1084


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,411,430
Number of Sequences: 5004
Number of extensions: 43198
Number of successful extensions: 82
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 82
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 82
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 305854096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)