BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0960 (664 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23G3.11 |rpn6||19S proteasome regulatory subunit Rpn6|Schizo... 26 4.2 SPAC30.01c |sec72|sec7b|Sec7 domain|Schizosaccharomyces pombe|ch... 26 5.6 SPAC6G10.04c |||20S proteasome component alpha 6 subunit Pre5|Sc... 25 7.4 SPBC17G9.12c |||conserved fungal protein|Schizosaccharomyces pom... 25 9.7 SPAC1142.09 ||SPAC8C9.02|dubious|Schizosaccharomyces pombe|chr 1... 25 9.7 SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 9.7 >SPAC23G3.11 |rpn6||19S proteasome regulatory subunit Rpn6|Schizosaccharomyces pombe|chr 1|||Manual Length = 421 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/49 (24%), Positives = 29/49 (59%) Frame = +1 Query: 7 EVSRLKTYFENTSFTDLINSSDGWEN*FSRITPELSVSELIFHVITSEI 153 E + Y++N+S+TD IN + + R+ ++ ++E+ H++ S++ Sbjct: 128 ETKLISLYYDNSSYTDAINLINTLLSELKRMDDKMLLTEV--HLLESKV 174 >SPAC30.01c |sec72|sec7b|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1822 Score = 25.8 bits (54), Expect = 5.6 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 53 SVNEVFSKYVFNLL 12 SVNE FSKYVF +L Sbjct: 1393 SVNETFSKYVFPVL 1406 >SPAC6G10.04c |||20S proteasome component alpha 6 subunit Pre5|Schizosaccharomyces pombe|chr 1|||Manual Length = 272 Score = 25.4 bits (53), Expect = 7.4 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = -2 Query: 624 QDYTIKIFNKDKQYLIYSQFDNRRQEQKFDNK 529 ++ +I + KD++Y +Y Q D + K +K Sbjct: 208 ENVSISVIGKDEKYTLYDQNDTKEWLDKLGDK 239 >SPBC17G9.12c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 274 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 43 SFTDLINSSDGWEN*FSRITPELSVSELIFHVIT 144 + LI G+ + + P+L VS+ IFHV++ Sbjct: 91 NIVQLITLRAGFVEFINALVPDLRVSKTIFHVLS 124 >SPAC1142.09 ||SPAC8C9.02|dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 115 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 442 IMYKRYIKSIKKTLHTLHTVYLSTHACILFIVKL 543 I +K YI+ + KT ++ + +S + CI FI+ L Sbjct: 60 IDFKSYIEFVLKTNNSYSAILISYYRCI-FIISL 92 >SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 106 Score = 25.0 bits (52), Expect = 9.7 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = -3 Query: 131 KISSETLSSGVIREN*FSHPSELLIKSVNEVFSKYVFNLLTSC 3 KISS +LS+ F H S + +KS++ + S+++F L+SC Sbjct: 20 KISSISLSNSF-----FPH-SFMFVKSLHLMTSQHIFKCLSSC 56 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,491,749 Number of Sequences: 5004 Number of extensions: 47645 Number of successful extensions: 106 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 301829700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -