BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0960 (664 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15224| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_56089| Best HMM Match : CLN3 (HMM E-Value=9.8e-07) 29 2.6 >SB_15224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1060 Score = 31.1 bits (67), Expect = 0.84 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +1 Query: 58 INSSDGWEN*FSRITPELSV-SELIFHVITSEIPE 159 + S+ W++ SR+ EL V +EL+F V+TS PE Sbjct: 339 VESAGSWKHLVSRLLTELFVVAELVFPVVTSSSPE 373 >SB_56089| Best HMM Match : CLN3 (HMM E-Value=9.8e-07) Length = 554 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 282 VKVSSAPRKSIY*YVKQKLCIPFYE 356 +K S R+ IY Y Q++C+PFY+ Sbjct: 325 LKGDSRIRQEIYQYESQEICVPFYQ 349 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,278,259 Number of Sequences: 59808 Number of extensions: 316897 Number of successful extensions: 611 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 582 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -