BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0960 (664 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g52310.1 68414.m05902 protein kinase family protein / C-type ... 28 4.8 At5g24080.1 68418.m02828 protein kinase family protein contains ... 28 6.4 >At1g52310.1 68414.m05902 protein kinase family protein / C-type lectin domain-containing protein contains protein kinase domain, Pfam:PF00069, PF00059 Lectin C-type domain Length = 552 Score = 28.3 bits (60), Expect = 4.8 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = +1 Query: 49 TDLINSSDGWEN*FSRITPELSVS---ELIFHVITSEIPE 159 T +NSS GW++ F TP + + E++ VIT +PE Sbjct: 471 TQAVNSSVGWQSIFEWATPLVQANRWLEILDPVITCGLPE 510 >At5g24080.1 68418.m02828 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 470 Score = 27.9 bits (59), Expect = 6.4 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = -3 Query: 176 SKRLGTSGISEVIT*KISSETLSSGVIREN*FSHPSELLIKSVNEVFSKYVFNLLTSC 3 S+ LG+ G V ++ ETL + + SH I VN + S + NL+ C Sbjct: 131 SQLLGSGGFGTVYKGTVAGETLVAVKRLDRALSHGEREFITEVNTIGSMHHMNLVRLC 188 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,065,287 Number of Sequences: 28952 Number of extensions: 213666 Number of successful extensions: 417 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1393347168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -