BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0959 (693 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81050-9|CAB02858.2| 400|Caenorhabditis elegans Hypothetical pr... 28 7.3 Z81043-5|CAB02802.2| 278|Caenorhabditis elegans Hypothetical pr... 27 9.6 >Z81050-9|CAB02858.2| 400|Caenorhabditis elegans Hypothetical protein C50B6.11 protein. Length = 400 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +3 Query: 27 MFYLFIICYK-YVFRYFLVTTNYFLFNAYC 113 MF+ + +K ++FR F + NYFL + C Sbjct: 1 MFFFLVEAFKIFIFRIFSLQNNYFLSSISC 30 >Z81043-5|CAB02802.2| 278|Caenorhabditis elegans Hypothetical protein C29F3.6 protein. Length = 278 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +3 Query: 21 FNMFYLFIICYKYVFRYFLVTTNYFLFNAYCASAIYELKTIT--IISIVRLL 170 ++ YLF C+ FL N F+F + + +++ +T IIS+ R + Sbjct: 57 YSSLYLFYFCFMDFLDVFLFQENVFIF-GFLVAVFHDVSVLTHFIISLNRFI 107 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,757,626 Number of Sequences: 27780 Number of extensions: 276421 Number of successful extensions: 792 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 792 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -