BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0957 (678 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0139 - 1008675-1008752,1008828-1008905,1009176-1009227,100... 28 6.0 06_02_0020 - 10675108-10676101,10676204-10676865,10676981-10677322 28 7.9 >02_01_0139 - 1008675-1008752,1008828-1008905,1009176-1009227, 1009369-1009437,1009594-1009652,1009757-1009828, 1009945-1010038,1010311-1010356,1010510-1010609, 1010847-1011200,1011362-1011460,1011548-1011595, 1011679-1011816 Length = 428 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -1 Query: 330 HRSLLNNIAMLIIKKSTDKL*NHQYCYSNSNKTW 229 H ++L I ++I+ DK HQ+ Y + KTW Sbjct: 291 HYNVLEQILAVLIQFVKDKKLEHQHQYDDLKKTW 324 >06_02_0020 - 10675108-10676101,10676204-10676865,10676981-10677322 Length = 665 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 81 TCKHINSTYYVTSKCITGLICLNIL 7 +C+H ++T Y S T LIC+ IL Sbjct: 292 SCRHSDTTIYALSLVATVLICIGIL 316 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,368,445 Number of Sequences: 37544 Number of extensions: 189846 Number of successful extensions: 287 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 287 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -