BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0957 (678 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 2.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 3.5 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 6.2 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 6.2 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 23.0 bits (47), Expect = 2.7 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +2 Query: 65 FICLHVLYIVMTAILKSIYTFLNFVN 142 F+C+ ++YI+M I + NF++ Sbjct: 402 FLCISLVYIIMLIIFIPRNIYENFIS 427 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/41 (26%), Positives = 17/41 (41%) Frame = -1 Query: 168 IIALQYNALFTKLRNVYILFNIAVITMYKTCKHINSTYYVT 46 +IA Y + + VY + + + KHI T Y T Sbjct: 817 MIAFAYPIMLIVVCTVYAVLTRKIPEAFNESKHIGFTMYTT 857 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 6.2 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = -1 Query: 153 YNALFTKLRNVYILFNIAVITMYKTCKHINSTYYVTSKCITGL 25 YNAL + VY + + + K I T Y T CI L Sbjct: 680 YNALLILISTVYAVKTRKIPENFNESKFIGFTMYTT--CIIWL 720 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 6.2 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = -1 Query: 153 YNALFTKLRNVYILFNIAVITMYKTCKHINSTYYVTSKCITGL 25 YNAL + VY + + + K I T Y T CI L Sbjct: 770 YNALLILISTVYAVKTRKIPENFNESKFIGFTMYTT--CIIWL 810 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,456 Number of Sequences: 438 Number of extensions: 3483 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -