BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0955 (697 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 3.7 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 4.8 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 6.4 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 8.5 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 21 QPRQLTGRTQGL*QHHRARSR*FGSSSKNPY 113 Q +QL TQ QH+ + +SS +PY Sbjct: 114 QQQQLAAETQQQQQHNNGYASPMSTSSYDPY 144 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 22.2 bits (45), Expect = 4.8 Identities = 7/20 (35%), Positives = 16/20 (80%) Frame = +2 Query: 527 NIFIINISIQRYL*DLVYCL 586 N+F+IN++I +L +++C+ Sbjct: 88 NLFVINLAISNFL--MMFCM 105 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -2 Query: 492 GTFLQIRLNYKLNLVTDHVWFANYLPRAFYIM 397 G + ++ L++KL + F YLP +M Sbjct: 226 GIYQRLSLSFKLQRNIGYFVFQTYLPSILIVM 257 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -2 Query: 336 KLLMCLVDPQRARYLRTS 283 KL++CL+DP+ + +S Sbjct: 88 KLVICLIDPRDVEIILSS 105 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,021 Number of Sequences: 438 Number of extensions: 4713 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -