BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0954 (624 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0361 - 22711200-22712180,22712523-22712729,22715205-227159... 28 5.2 07_03_0842 - 21952483-21954135,21957361-21958108,21958266-21958534 28 5.2 09_01_0139 - 2074193-2077146,2077549-2078043,2078983-2079190 27 9.2 03_05_0887 - 28527602-28530555,28531296-28531790,28532377-28532584 27 9.2 03_05_0886 - 28516210-28519163,28519577-28520071,28520757-28520964 27 9.2 >11_06_0361 - 22711200-22712180,22712523-22712729,22715205-22715903, 22717848-22717979,22720422-22721180,22721241-22721453 Length = 996 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 315 FSYYFFGCIFICTLYSFRVWLY 250 FSYY C+F L SFR+ LY Sbjct: 312 FSYYHCVCMFFKELVSFRILLY 333 >07_03_0842 - 21952483-21954135,21957361-21958108,21958266-21958534 Length = 889 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 457 IFYYNIKLIVFHSVQTIYIEQPMALYIAYSRQIIS 561 IF+YN+ +++ + YI+QP Y+ Y II+ Sbjct: 664 IFFYNLFPVMWLISEQYYIQQPFGEYLLYLVAIIA 698 >09_01_0139 - 2074193-2077146,2077549-2078043,2078983-2079190 Length = 1218 Score = 27.5 bits (58), Expect = 9.2 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = -1 Query: 273 YSFRVWLYRSF*CLHYVYNYMDRLKSIFF 187 Y +VW Y++ CL ++ ++D ++++ F Sbjct: 73 YKIKVWNYKTHRCLFTLHGHLDYIRTVQF 101 >03_05_0887 - 28527602-28530555,28531296-28531790,28532377-28532584 Length = 1218 Score = 27.5 bits (58), Expect = 9.2 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = -1 Query: 273 YSFRVWLYRSF*CLHYVYNYMDRLKSIFF 187 Y +VW Y++ CL ++ ++D ++++ F Sbjct: 73 YKIKVWNYKTHRCLFTLHGHLDYIRTVQF 101 >03_05_0886 - 28516210-28519163,28519577-28520071,28520757-28520964 Length = 1218 Score = 27.5 bits (58), Expect = 9.2 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = -1 Query: 273 YSFRVWLYRSF*CLHYVYNYMDRLKSIFF 187 Y +VW Y++ CL ++ ++D ++++ F Sbjct: 73 YKIKVWNYKTHRCLFTLHGHLDYIRTVQF 101 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,373,714 Number of Sequences: 37544 Number of extensions: 217525 Number of successful extensions: 347 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 347 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1513903616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -