BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0954 (624 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT024967-1|ABE01197.1| 604|Drosophila melanogaster IP15225p pro... 31 0.96 AY051963-1|AAK93387.1| 448|Drosophila melanogaster LD43003p pro... 31 0.96 AE014298-1624|AAS65315.1| 448|Drosophila melanogaster CG1745-PA... 31 0.96 AE014298-1623|AAF48046.1| 837|Drosophila melanogaster CG1745-PB... 31 0.96 >BT024967-1|ABE01197.1| 604|Drosophila melanogaster IP15225p protein. Length = 604 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = +1 Query: 238 LKRSIKPN--SKRVQSTNKNTSKEIIRKKSAHF 330 LKRS KP +KR+ S +NT +++++ AHF Sbjct: 257 LKRSHKPKIKAKRLSSRGRNTDPDLVKRYGAHF 289 >AY051963-1|AAK93387.1| 448|Drosophila melanogaster LD43003p protein. Length = 448 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = +1 Query: 238 LKRSIKPN--SKRVQSTNKNTSKEIIRKKSAHF 330 LKRS KP +KR+ S +NT +++++ AHF Sbjct: 257 LKRSPKPKIKAKRLSSRGRNTDPDLVKRYGAHF 289 >AE014298-1624|AAS65315.1| 448|Drosophila melanogaster CG1745-PA, isoform A protein. Length = 448 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = +1 Query: 238 LKRSIKPN--SKRVQSTNKNTSKEIIRKKSAHF 330 LKRS KP +KR+ S +NT +++++ AHF Sbjct: 257 LKRSPKPKIKAKRLSSRGRNTDPDLVKRYGAHF 289 >AE014298-1623|AAF48046.1| 837|Drosophila melanogaster CG1745-PB, isoform B protein. Length = 837 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = +1 Query: 238 LKRSIKPN--SKRVQSTNKNTSKEIIRKKSAHF 330 LKRS KP +KR+ S +NT +++++ AHF Sbjct: 257 LKRSPKPKIKAKRLSSRGRNTDPDLVKRYGAHF 289 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,432,104 Number of Sequences: 53049 Number of extensions: 428544 Number of successful extensions: 733 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2579793750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -