BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0953 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 3e-21 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 5e-21 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 97 8e-21 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 97 1e-20 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 96 2e-20 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 96 2e-20 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 96 2e-20 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 96 2e-20 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 96 2e-20 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 96 2e-20 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 3e-20 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 3e-20 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 96 3e-20 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 96 3e-20 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 3e-20 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 3e-20 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 96 3e-20 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 96 3e-20 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 3e-20 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 96 3e-20 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 3e-20 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 3e-20 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 3e-20 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 3e-20 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 95 6e-20 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 1e-19 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 94 1e-19 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 93 1e-19 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 1e-19 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 1e-19 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 93 1e-19 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 93 2e-19 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 93 2e-19 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 93 2e-19 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 93 2e-19 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 93 2e-19 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 93 2e-19 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 92 3e-19 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 92 3e-19 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 92 3e-19 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 92 3e-19 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 92 3e-19 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 92 3e-19 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 92 3e-19 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 92 3e-19 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 92 3e-19 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 92 3e-19 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 92 3e-19 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 92 3e-19 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 92 3e-19 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 92 3e-19 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 92 3e-19 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 92 3e-19 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 92 3e-19 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 92 3e-19 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 92 3e-19 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 92 3e-19 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 92 3e-19 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 92 3e-19 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 92 3e-19 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 92 3e-19 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 92 3e-19 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 92 3e-19 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 92 3e-19 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 92 3e-19 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 92 3e-19 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 92 3e-19 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 92 3e-19 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 92 3e-19 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 92 3e-19 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 92 3e-19 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 92 3e-19 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 92 3e-19 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 92 3e-19 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 92 3e-19 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 92 3e-19 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 92 3e-19 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 92 3e-19 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 92 3e-19 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 92 3e-19 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 92 3e-19 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 92 3e-19 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 92 3e-19 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 92 3e-19 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 92 3e-19 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 92 3e-19 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 92 3e-19 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 92 3e-19 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 92 3e-19 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 92 3e-19 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 92 3e-19 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 92 3e-19 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 92 3e-19 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 92 3e-19 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 92 3e-19 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 92 3e-19 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 92 3e-19 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 92 3e-19 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 3e-19 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 92 4e-19 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 92 4e-19 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 92 4e-19 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 92 4e-19 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 92 4e-19 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 92 4e-19 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 92 4e-19 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 92 4e-19 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 92 4e-19 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 92 4e-19 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 92 4e-19 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 92 4e-19 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 92 4e-19 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 92 4e-19 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 92 4e-19 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 92 4e-19 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 92 4e-19 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 92 4e-19 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 92 4e-19 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 92 4e-19 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 92 4e-19 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 92 4e-19 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 92 4e-19 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 92 4e-19 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 92 4e-19 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 92 4e-19 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 92 4e-19 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 92 4e-19 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 92 4e-19 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 92 4e-19 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 92 4e-19 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 92 4e-19 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 92 4e-19 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 92 4e-19 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 92 4e-19 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 92 4e-19 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 92 4e-19 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 92 4e-19 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 99.1 bits (236), Expect = 3e-21 Identities = 47/61 (77%), Positives = 50/61 (81%) Frame = -1 Query: 591 NINAYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASE 412 N+ A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 440 NMGASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 497 Query: 411 L 409 L Sbjct: 498 L 498 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 98.3 bits (234), Expect = 5e-21 Identities = 43/61 (70%), Positives = 50/61 (81%) Frame = -1 Query: 594 QNINAYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 ++++ + P+ +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 518 ESVSRNSTPYTQRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 577 Query: 414 E 412 E Sbjct: 578 E 578 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 97.5 bits (232), Expect = 8e-21 Identities = 46/60 (76%), Positives = 49/60 (81%) Frame = -1 Query: 588 INAYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 + A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 175 VGASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 97.1 bits (231), Expect = 1e-20 Identities = 44/51 (86%), Positives = 45/51 (88%) Frame = -1 Query: 561 IXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 I +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 239 IRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 96.3 bits (229), Expect = 2e-20 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 96.3 bits (229), Expect = 2e-20 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 214 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 96.3 bits (229), Expect = 2e-20 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 369 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 96.3 bits (229), Expect = 2e-20 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 285 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 96.3 bits (229), Expect = 2e-20 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 96.3 bits (229), Expect = 2e-20 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 96.3 bits (229), Expect = 2e-20 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 96.3 bits (229), Expect = 2e-20 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 25 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 96.3 bits (229), Expect = 2e-20 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 259 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 96.3 bits (229), Expect = 2e-20 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 278 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 96.3 bits (229), Expect = 2e-20 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 128 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 96.3 bits (229), Expect = 2e-20 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 96.3 bits (229), Expect = 2e-20 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 96.3 bits (229), Expect = 2e-20 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 579 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 96.3 bits (229), Expect = 2e-20 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 493 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 96.3 bits (229), Expect = 2e-20 Identities = 45/56 (80%), Positives = 48/56 (85%), Gaps = 1/56 (1%) Frame = -1 Query: 573 LPFAIX-VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 +P A+ +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 76 MPEAVSGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 95.9 bits (228), Expect = 3e-20 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 889 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 95.9 bits (228), Expect = 3e-20 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 95.9 bits (228), Expect = 3e-20 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 225 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 95.9 bits (228), Expect = 3e-20 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 358 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 95.9 bits (228), Expect = 3e-20 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 95.9 bits (228), Expect = 3e-20 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 95.9 bits (228), Expect = 3e-20 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 268 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 95.9 bits (228), Expect = 3e-20 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 252 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 95.9 bits (228), Expect = 3e-20 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 95.9 bits (228), Expect = 3e-20 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 119 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 95.9 bits (228), Expect = 3e-20 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 194 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 95.9 bits (228), Expect = 3e-20 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 222 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 95.9 bits (228), Expect = 3e-20 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 409 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 391 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 95.5 bits (227), Expect = 3e-20 Identities = 47/63 (74%), Positives = 49/63 (77%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL*Y 403 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPG 59 Query: 402 DSL 394 D L Sbjct: 60 DPL 62 Score = 91.5 bits (217), Expect = 5e-19 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = +2 Query: 416 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLANSEEARTDRPSQQLRT 556 LAVVLQRRDWENPGVTQLNRLAAHPPF NSEEARTDRPSQQLR+ Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 131 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 95.1 bits (226), Expect = 4e-20 Identities = 41/58 (70%), Positives = 46/58 (79%) Frame = -2 Query: 554 CATVGKGDRCGPLRYSPAGEKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 381 CATVGKGDRCG +PAGE+G + +G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 94.7 bits (225), Expect = 6e-20 Identities = 48/68 (70%), Positives = 50/68 (73%), Gaps = 4/68 (5%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTASE----L*YDSL*G 388 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS L DS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS 83 Query: 387 ELGTGPHS 364 L GPH+ Sbjct: 84 PLRWGPHA 91 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 93.9 bits (223), Expect = 1e-19 Identities = 43/52 (82%), Positives = 44/52 (84%) Frame = -1 Query: 570 PFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 P A +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 52 PQAPRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 103 >SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) Length = 629 Score = 93.9 bits (223), Expect = 1e-19 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = -1 Query: 576 NLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTA 418 +L ++I +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTA Sbjct: 457 SLFYSIRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 509 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 93.5 bits (222), Expect = 1e-19 Identities = 42/49 (85%), Positives = 43/49 (87%) Frame = -1 Query: 561 IXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 I +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 295 ILLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 343 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 93.5 bits (222), Expect = 1e-19 Identities = 44/54 (81%), Positives = 45/54 (83%) Frame = +2 Query: 416 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLANSEEARTDRPSQQLRTXMANGKL 577 LAVVLQRRDWENPGVTQLNRLAAHPPF NSEEARTDRPSQQLRT +L Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTLNGEWRL 92 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 93.5 bits (222), Expect = 1e-19 Identities = 42/49 (85%), Positives = 43/49 (87%) Frame = -1 Query: 561 IXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 I +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 127 ITLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 175 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 93.5 bits (222), Expect = 1e-19 Identities = 43/55 (78%), Positives = 46/55 (83%), Gaps = 2/55 (3%) Frame = -1 Query: 573 LPFA--IXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +PF + +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 92 IPFVALLKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 146 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 93.1 bits (221), Expect = 2e-19 Identities = 42/50 (84%), Positives = 43/50 (86%) Frame = -1 Query: 564 AIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 A +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 144 ACLLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 193 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 93.1 bits (221), Expect = 2e-19 Identities = 41/49 (83%), Positives = 43/49 (87%) Frame = -1 Query: 561 IXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 + +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 366 VVLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 414 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 93.1 bits (221), Expect = 2e-19 Identities = 43/47 (91%), Positives = 43/47 (91%) Frame = +2 Query: 416 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLANSEEARTDRPSQQLRT 556 LAVVLQRRDWENPGVTQLNRLAAHPPF NSEEARTDRPSQQLRT Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRT 76 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 93.1 bits (221), Expect = 2e-19 Identities = 42/50 (84%), Positives = 43/50 (86%) Frame = -1 Query: 564 AIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 A +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 787 ACLLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 836 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 93.1 bits (221), Expect = 2e-19 Identities = 42/50 (84%), Positives = 43/50 (86%) Frame = -1 Query: 564 AIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 A +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 369 ACLLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 418 >SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) Length = 1160 Score = 93.1 bits (221), Expect = 2e-19 Identities = 43/59 (72%), Positives = 47/59 (79%) Frame = -1 Query: 591 NINAYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 N ++ L + +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 842 NASSSQLVNSSSLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 900 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 92.7 bits (220), Expect = 2e-19 Identities = 46/62 (74%), Positives = 49/62 (79%) Frame = -1 Query: 594 QNINAYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +N A + PF + RNC EGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 39 KNQGASHSPFRL--RNCGEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 96 Query: 414 EL 409 EL Sbjct: 97 EL 98 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 92.7 bits (220), Expect = 2e-19 Identities = 42/51 (82%), Positives = 43/51 (84%) Frame = -1 Query: 567 FAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 F +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 447 FIRWLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 497 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 92.7 bits (220), Expect = 2e-19 Identities = 44/56 (78%), Positives = 46/56 (82%) Frame = -1 Query: 582 AYNLPFAIXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 A + PF + RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 83 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/49 (83%), Positives = 43/49 (87%) Frame = -1 Query: 561 IXVRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 + +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 53 LRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 101 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 92.7 bits (220), Expect = 2e-19 Identities = 49/80 (61%), Positives = 53/80 (66%) Frame = +2 Query: 338 RHSSASAKREWGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFRQLANSE 517 RH+S +RE G LAVVLQRRDWENPGVTQLNRLAAHPPF NSE Sbjct: 4 RHAS---RREKGGQVSESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 60 Query: 518 EARTDRPSQQLRTXMANGKL 577 EARTDRPSQQLR+ +L Sbjct: 61 EARTDRPSQQLRSLNGEWRL 80 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 477 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 224 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 270 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 70 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 651 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 560 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 606 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 407 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 453 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 34 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 80 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 1106 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 1152 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 111 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 157 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 487 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 533 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 95 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 141 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRA SLF KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRAYSLFRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 51 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 97 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 156 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 202 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 92.3 bits (219), Expect = 3e-19 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +2 Query: 416 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLANSEEARTDRPSQQLRT 556 LAVVLQRRDWENPGVTQLNRLAAHPPF +NSEEARTDRPSQQLR+ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWSNSEEARTDRPSQQLRS 84 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 193 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 239 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 56 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 102 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) Length = 229 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 113 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 159 >SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 919 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 965 >SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 165 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 211 Score = 91.5 bits (217), Expect = 5e-19 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = +2 Query: 416 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLANSEEARTDRPSQQLRT 556 LAVVLQRRDWENPGVTQLNRLAAHPPF NSEEARTDRPSQQLR+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 95 >SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 92.3 bits (219), Expect = 3e-19 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 555 VRNCWEGRSVRASSLFASWRKGGCAARRLSWVTPGFSQSRRCKTTAS 415 +RNCWEGRSVRASSL KGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 24 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,255,516 Number of Sequences: 59808 Number of extensions: 481986 Number of successful extensions: 5202 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5013 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5185 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -