BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0952 (683 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 26 0.96 DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. 24 5.1 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 24 5.1 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 23 9.0 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 23 9.0 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 9.0 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 26.2 bits (55), Expect = 0.96 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +1 Query: 388 LVGLNGCGKSSLLAAL 435 LVG NG GKS++LAA+ Sbjct: 112 LVGKNGSGKSAILAAM 127 >DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. Length = 482 Score = 23.8 bits (49), Expect = 5.1 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -1 Query: 521 LKCSLSEAGISRVRWNMSMCSGIGTSRRPKAASNDD 414 L+ SLS A + R+ W M M I R A++ D Sbjct: 341 LQASLSSAELDRLIWQMKMHKAIVQFPRMHASNTYD 376 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +1 Query: 439 RREVPIPEHIDIFHLTREMPASDRLHFSASWRL 537 R VP+P I HL S + +SW L Sbjct: 512 RGTVPLPARITALHLASVSSRSQLMKLPSSWDL 544 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 597 ESQEQLMDVYDRLDDLSADT 656 E+ + L D +DRL D+S T Sbjct: 149 ETMDDLQDYWDRLFDISIST 168 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 428 ASNDDFPHPLSPTSPYLRPQ 369 ASN D P ++ T YL+P+ Sbjct: 1142 ASNVDVPSTIAETDEYLQPK 1161 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 633,708 Number of Sequences: 2352 Number of extensions: 12774 Number of successful extensions: 56 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -