BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0951 (673 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0981 + 12917195-12917572,12917661-12917818,12918732-129187... 28 5.9 07_03_1496 + 26986625-26986791,26987757-26987913,26988008-26988055 28 7.8 >03_02_0981 + 12917195-12917572,12917661-12917818,12918732-12918765, 12918942-12919074,12919167-12919221,12919281-12920064, 12920440-12920769,12920788-12920895,12921259-12921678, 12921775-12921847,12922291-12922376,12922873-12922992, 12923086-12923156,12923350-12923449 Length = 949 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 114 R*GRCSNCILNWVNCYAIDNVKK 182 R G C+NCI W + ID+V+K Sbjct: 168 RRGYCTNCISRWYSDIPIDDVRK 190 >07_03_1496 + 26986625-26986791,26987757-26987913,26988008-26988055 Length = 123 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -3 Query: 434 QLPLALRTNLFKILQIFPPY-KHTYLVGRY 348 + P R LFK Q F KHTYL GRY Sbjct: 59 EAPFVPREKLFKQQQYFQNLTKHTYLKGRY 88 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,601,669 Number of Sequences: 37544 Number of extensions: 224331 Number of successful extensions: 269 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 269 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -